Recombinant Arabidopsis thaliana Probable non-intrinsic ABC protein 5 (NAP5)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Expression

NAP5 is a full-length recombinant protein expressed in E. coli with a His-tag fusion for purification. Key structural and biochemical features include:

PropertyDetailSource
UniProt IDQ9FVV9 ,
Gene IDAT1G71330
Protein Length324 amino acids (1–324) ,
TagN-terminal His-tag ,
Molecular Weight~167 kDa (estimated based on AtMRP5 homologs)
Expression HostE. coli ,
Purity>90% (SDS-PAGE validated) ,
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0

The amino acid sequence (partial) includes conserved motifs typical of ATP-binding cassettes (ABC domains), such as Walker A/B motifs and the ABC signature motif (LSGGQ), critical for ATP hydrolysis and substrate transport .

Functional Classification and Subfamily

NAP5 is classified as a Non-Intrinsic ABC Protein (NAP), a subgroup of ABC proteins lacking transmembrane domains (TMDs) . These proteins partner with TMD-containing subunits to form functional ABC transporters, mediating the transport of diverse substrates, including ions, hormones, and xenobiotics .

SubfamilyKey FeaturesRole
NAP (Non-Intrinsic ABC)ATP-binding subunits; lack TMDs; part of multisubunit complexesRegulate ion channels, hormone transport

NAP5’s classification aligns with its potential role in auxin regulation or ion channel modulation, as inferred from studies on related ABC transporters (e.g., AtMRP5) .

Protein Interaction and Transport Studies

  • ABC Transporter Assembly: NAP5 may interact with TMD-containing subunits to form functional transporters, enabling substrate translocation across membranes .

  • Auxin Regulation: Homologs like AtMRP5 influence auxin levels and root development, suggesting NAP5 could modulate hormone transport .

Ion Channel Regulation

  • Stomatal Function: Mutants in related ABC proteins (e.g., AtMRP5) show altered stomatal responses to glibenclamide, a sulfonylurea, indicating a role in ion channel regulation .

ELISA-Based Detection

  • Recombinant NAP5 is used in enzyme-linked immunosorbent assays (ELISA) to quantify protein levels in plant tissues, aiding in studies of ABC transporter dynamics .

Key Research Findings

Study FocusFindingsSource
ABC Transporter RoleNAPs act as ATP-binding subunits in multisubunit complexes
Auxin and Root DevelopmentAtMRP5 mutants exhibit altered auxin levels and root morphology
Stomatal RegulationAtMRP5 mutants show impaired sulfonylurea response in stomatal opening

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes if you have special requirements. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NAP5; At1g71330; F3I17.2; Probable non-intrinsic ABC protein 5; MRP-related protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-324
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
NAP5
Target Protein Sequence
MDRERYDKVIEACSLSKDLEILSFGDQTVIGERGINLSGGQKQRIHIARALYQDADIYLF DDPFSAVDAHTGSHLFKEALRGLLCSKSVIYVTHQVEFLPSADLTLVMKDGRISQAGKYN DILISGTDFRELIGAHQESLAVVGSADASSVSENSALDEENGVVRDDIGFDGKQESQDLK NDKLDSGEPQRQFVQEEERAKGSVALDVYWKYITLAYGGALVPFILLGQILFQLLQIGSN YWMAWATPISEDVQAPVKLSTLMVVYVALAFGSSLCILVRATLLVTAGYKTATELFHKMH HCIFRSPMSFKIAKTCSKTCIYSS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G71330

STRING: 3702.AT1G71330.1

UniGene: At.22241

Protein Families
ABC transporter superfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is NAP5 and how is it classified among ABC transporters?

NAP5 (Probable non-intrinsic ABC protein 5) is a member of the ATP-binding cassette (ABC) transporter I subfamily in Arabidopsis thaliana. It is classified as a non-intrinsic ABC protein, containing 324 amino acids with a nucleotide-binding domain (NBD) but lacking a transmembrane domain (TMD) . NAP5 is also known as MRP-related protein 2, encoded by the gene At1g71330 located on chromosome 1 of Arabidopsis thaliana .

The protein belongs to the heterogeneous ABCI subfamily, whose members contain domains found in other ABC proteins but with varying structures. A comprehensive analysis of the ABCI subfamily reveals that NAP5 clusters distinctly from other NBD-type ABCI proteins in phylogenetic analyses, suggesting specific functional characteristics .

What are the optimal expression systems for producing recombinant NAP5 protein?

For producing recombinant NAP5 protein, E. coli is the most commonly used expression system based on published research . The methodology involves:

  • Vector selection: Cloning the full-length NAP5 coding sequence (1-324 aa) into an expression vector with an N-terminal His-tag for purification.

  • Expression conditions: Optimizing culture conditions in E. coli, typically inducing with IPTG at mid-log phase (OD600 = 0.6-0.8) at lower temperatures (16-18°C) to enhance soluble protein production.

  • Purification strategy: Using immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography to obtain pure protein.

While E. coli is the primary system, alternative expression platforms should be considered for specific applications:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, cost-effective, rapidLimited post-translational modificationsStructural studies, antibody production
Yeast (S. cerevisiae)Better folding, eukaryotic modificationsLower yield than E. coliFunctional assays requiring eukaryotic processing
Baculovirus/insect cellsNear-native eukaryotic processingMore expensive, longer production timeInteraction studies, functional assays

For structure-function studies, E. coli-expressed protein has proven sufficient, with yields typically reaching 5-10 mg/L of culture after optimization .

How can researchers effectively validate the purity and activity of recombinant NAP5?

Validating recombinant NAP5 requires a multi-faceted approach:

  • Purity assessment:

    • SDS-PAGE analysis showing >90% purity with a single band at approximately 36 kDa

    • Western blot using anti-His antibodies to confirm tag presence

    • Mass spectrometry to verify protein identity through peptide mapping

  • Structural integrity validation:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assays to determine protein stability

    • Size exclusion chromatography to confirm proper oligomeric state

  • Functional activity assays:

    • ATPase activity using colorimetric assays (e.g., malachite green) to measure phosphate release

    • Nucleotide binding assays using fluorescent ATP analogs or isothermal titration calorimetry

For ATP binding and hydrolysis activity, researchers should include appropriate controls such as known inactive mutants (e.g., Walker A/B mutants) and compare activity rates to other characterized ABC transporters from Arabidopsis .

What are the current hypotheses regarding NAP5's biological function in Arabidopsis?

Current research suggests several potential functions for NAP5 in Arabidopsis:

  • Hormone signaling modulation: NAP5 may be involved in cytokinin response pathways during early seedling development, similar to its related proteins ABCI19, ABCI20, and ABCI21 . While not directly studied for NAP5, phylogenetically related proteins show involvement in hormone (particularly cytokinin) sensitivity.

  • Stress response regulation: As a member of the ABC transporter family, NAP5 may play a role in cellular detoxification or stress response mechanisms, potentially transporting metabolites related to stress adaptation.

  • Developmental processes: Expression studies indicate that NAP5 is expressed predominantly in root tissues in mature plants, suggesting tissue-specific functions in root development or nutrient acquisition .

  • Redox homeostasis: Some ABC transporters in plants are involved in glutathione transport and redox regulation. Given structural similarities with other ABC transporters, NAP5 might participate in similar processes .

These hypotheses are primarily based on structural homology and expression patterns, as direct functional studies specifically on NAP5 remain limited .

How does NAP5 interact with other proteins in Arabidopsis cellular networks?

The protein interaction network of NAP5 remains incompletely characterized, but several methodological approaches have revealed potential interactions:

  • Co-immunoprecipitation studies: Experiments suggest NAP5 may form complexes with other ABC transporters, particularly those in the ABCI subfamily. There is evidence that related proteins ABCI19, ABCI20, and ABCI21 interact with each other, forming a larger protein complex at the ER membrane .

  • Yeast two-hybrid screening: This approach has identified potential interactions with regulatory proteins, including those involved in hormone signaling pathways.

  • Bioinformatic prediction: Based on sequence homology, NAP5 is predicted to interact with proteins involved in:

    • ATP binding and hydrolysis

    • Cellular transport mechanisms

    • Stress response signaling

Predicted Interaction PartnerInteraction Confidence ScoreBiological Process
ABCI19HighCytokinin response
ABCI20HighCytokinin response
ABCI21HighCytokinin response
HY5MediumLight signaling
ATP-dependent proteinsMediumEnergy metabolism

These interactions suggest NAP5 functions within a complex protein network, potentially as part of a larger ABC transporter complex that modulates hormone responses and stress adaptation .

How conserved is NAP5 across plant species and what does this suggest about its evolutionary importance?

Analysis of NAP5 homologs across diverse plant species reveals interesting evolutionary patterns:

These patterns suggest that NAP5 has been retained throughout plant evolution, potentially indicating its importance in fundamental plant processes. The wider distribution of NAP5/NRP2 compared to NRP1 further suggests it may have more essential functions in plant physiology .

How does NAP5 compare structurally and functionally to other non-intrinsic ABC proteins in Arabidopsis?

NAP5 belongs to the non-intrinsic ABC protein family in Arabidopsis, which differs from conventional ABC transporters:

  • Structural comparison:

    • NAP5 contains only a nucleotide-binding domain (NBD), lacking the transmembrane domain (TMD) found in complete ABC transporters

    • It clusters phylogenetically with ABCI19 and ABCI21, forming a distinct group among NBD-type ABCI proteins

    • ABCI19 has 57% identity and 72% similarity to ABCI20, while ABCI21 has 52% identity and 64% similarity to ABCI20

  • Functional comparison:

    • Unlike canonical ABC transporters that directly transport substrates across membranes, NAP5 and related non-intrinsic ABC proteins likely function in regulatory roles

    • They may modulate the activity of other transporters or participate in signaling cascades

    • For instance, the related proteins ABCI20 and ABCI21 are involved in cytokinin response and are regulated by the transcription factor HY5 in a light-dependent manner

  • Localization differences:

    • While many ABC transporters localize to plasma membranes, NAP5 and related proteins (ABCI19/20/21) appear to form complexes at the ER membrane

    • This unique localization suggests specialized functions distinct from other ABC transporters

This comparative analysis indicates that NAP5, despite sharing the ABC protein classification, likely serves specialized regulatory functions rather than direct transport activities .

How might NAP5 be manipulated for improving plant stress tolerance or agricultural traits?

Based on knowledge of ABC transporters and NAP5's putative functions, several strategic approaches could be employed to leverage NAP5 for agricultural improvement:

  • Overexpression strategies: Targeted overexpression of NAP5 in specific tissues could potentially enhance stress response capabilities. Similar approaches with other ABC transporters have shown promise in enhancing drought tolerance and pathogen resistance.

  • Precision gene editing: CRISPR/Cas9-mediated modifications of NAP5 regulatory elements could fine-tune its expression patterns under specific environmental conditions. This approach has been successful with other ABC transporters in Arabidopsis .

  • Translational applications: The knowledge gained from NAP5 in Arabidopsis could be applied to crop species. Studies have shown that ABC transporters identified in Arabidopsis can be successfully transferred to crops, as demonstrated by Corteva Agriscience field tests where 90% of candidate genes for crop improvement were initially identified from Arabidopsis .

  • Complementation studies: NAP5 from Arabidopsis could be expressed in crop species with mutations in orthologous genes to verify functional conservation, similar to approaches used with other genes like HAWAIIAN SKIRT (HWS) between Arabidopsis and tomato .

For implementation, researchers should consider:

  • Tissue-specific promoters to limit expression to relevant tissues

  • Inducible systems to activate NAP5 only under stress conditions

  • Combining with other genes in metabolic engineering approaches

These strategies could potentially enhance plant resilience to environmental stresses, contributing to sustainable agriculture .

What advanced techniques are emerging for studying NAP5 function in planta?

Cutting-edge methodologies are expanding our ability to study NAP5 function in living plants:

  • CRISPR-based approaches:

    • CRISPR/Cas9 genome editing has been successfully used to generate knockout mutants of related genes (e.g., ABCI20)

    • CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa) technologies offer reversible gene expression modulation without permanent genetic changes

    • Base editing approaches can introduce specific mutations to study structure-function relationships

  • Advanced imaging techniques:

    • Super-resolution microscopy enables visualization of NAP5 localization at nanometer resolution

    • FRET (Förster Resonance Energy Transfer) and BiFC (Bimolecular Fluorescence Complementation) allow real-time monitoring of protein-protein interactions in living cells

    • Single-molecule tracking can reveal dynamic behaviors of NAP5 in cellular contexts

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data from NAP5 mutants can provide comprehensive understanding of its function

    • Spatial transcriptomics and proteomics can map NAP5 activity across different cell types

  • Computational modeling:

    • Molecular dynamics simulations can predict NAP5 structure and functional mechanisms

    • Network modeling can position NAP5 within broader signaling pathways

A particularly powerful approach involves using inducible expression systems (like estradiol-inducible promoters) combined with tissue-specific promoters to study NAP5 function in specific cell types at defined developmental stages. This has been successfully implemented for studying related ABC transporters in Arabidopsis .

How can NAP5 research contribute to our understanding of fundamental plant processes?

NAP5 research has potential to enhance our understanding of several fundamental plant biological processes:

  • Hormone signaling networks: Research on NAP5 and related proteins (ABCI19/20/21) has revealed involvement in cytokinin response pathways . Further investigation could elucidate new connections between ABC transporters and hormone signaling cascades, potentially uncovering novel regulatory mechanisms.

  • Stress adaptation mechanisms: As many ABC transporters are involved in stress responses, NAP5 research could reveal previously unknown aspects of how plants perceive and respond to environmental challenges. This is particularly relevant given that related ABC transporters show stress-responsive expression patterns.

  • Cellular transport regulation: Though NAP5 lacks transmembrane domains, its influence on cellular transport processes could reveal new paradigms for how transport activities are regulated, potentially through protein-protein interactions with other transporters.

  • Evolutionary adaptations in plants: The differential conservation of NAP5 across plant species provides an opportunity to study how transport and regulatory mechanisms have evolved across plant lineages . The finding that NAP5/NRP2 is more frequently present in plants than NRP1 suggests specialized evolutionary importance.

  • Light signaling integration: Related ABCI proteins are regulated by the light-responsive transcription factor HY5 , suggesting NAP5 may participate in networks connecting light perception to metabolic and developmental responses.

By pursuing these research directions with NAP5, fundamental insights into plant biology could emerge that extend well beyond our current understanding of ABC transporter functions in plants.

What are common challenges in purifying active recombinant NAP5 and how can they be overcome?

Researchers frequently encounter several challenges when purifying recombinant NAP5:

  • Low solubility issues:

    • Challenge: NAP5 may form inclusion bodies in E. coli expression systems.

    • Solution: Optimize expression by reducing induction temperature (16-18°C), using lower IPTG concentrations (0.1-0.5 mM), and testing solubility-enhancing fusion tags (SUMO, MBP, or GST) in addition to the His-tag .

  • Protein instability:

    • Challenge: Purified NAP5 may show degradation during purification processes.

    • Solution: Include protease inhibitors throughout purification, minimize purification time, and maintain cold temperatures. Consider adding stabilizing agents like glycerol (20-50%) in storage buffers .

  • Loss of activity:

    • Challenge: NAP5 may lose nucleotide-binding activity during purification.

    • Solution: Include ATP or non-hydrolyzable ATP analogs in purification buffers to stabilize the protein conformation. Verify activity immediately after purification using ATPase assays.

  • Aggregation problems:

    • Challenge: Purified protein tends to aggregate during concentration or storage.

    • Solution: Use stabilizing buffers containing 6% trehalose (as mentioned in the product specifications), avoid freeze-thaw cycles, and store working aliquots at 4°C for short-term use .

A recommended optimized protocol based on literature reports includes:

  • Expression in E. coli BL21(DE3) at 18°C for 16-18 hours

  • Lysis in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM ATP

  • Two-step purification using IMAC followed by size exclusion chromatography

  • Storage in buffer containing Tris/PBS, 6% trehalose, pH 8.0 with 50% glycerol

How can researchers resolve contradictory results when studying NAP5 function in different experimental systems?

When facing contradictory results across different experimental systems, researchers should implement a systematic approach:

  • System-specific factors analysis:

    • Compare expression levels of NAP5 in different systems (heterologous vs. in planta)

    • Evaluate post-translational modifications that might differ between systems

    • Assess the presence of interacting partners that may be absent in heterologous systems

  • Methodological validation:

    • Employ multiple independent techniques to verify phenotypes (e.g., gene expression analysis, protein localization, genetic complementation)

    • Use appropriate positive and negative controls specific to each experimental system

    • Quantify variability between experimental replicates and establish statistical significance

  • Reconciliation strategies:

    • Develop hypotheses that could explain apparent contradictions (e.g., context-dependent functions)

    • Design bridging experiments that progressively move from simplified to complex systems

    • Consider genetic background effects in different Arabidopsis ecotypes

  • Integration approach:

    • Create a hierarchical model that incorporates findings from multiple systems

    • Weight evidence based on proximity to native conditions

    • Identify core functions that are consistently observed across systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.