Recombinant Arabidopsis thaliana Probable pectinesterase/pectinesterase inhibitor 34 (PME34)

Shipped with Ice Packs
In Stock

Description

Introduction

Arabidopsis thaliana Probable Pectinesterase/Pectinesterase Inhibitor 34 (PME34) is a protein that, in Arabidopsis thaliana, is encoded by the At3g49220 gene . PME34 is a type I PME that is localized to the plasma membrane and deposited in the cell wall . It functions during guard cell wall modification and has a role in regulating transpiration through the control of stomatal aperture during heat stress (HS) .

Gene Information

FeatureDescription
SpeciesArabidopsis thaliana (Mouse-ear cress)
Gene NamePME34
SynonymsPME34, ARATH13, At2g26450
UniProt IDQ9M3B0
Alternative NamesPectin methylesterase

Protein Properties

PropertyDescription
Product TypeTransmembrane Protein
SourceE. coli
TagHis-Tagged
Protein LengthFull Length (1-614 aa)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C, for extended storage, conserve at -20°C or -80°C
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0 or Tris-based buffer, 50% glycerol, optimized for this protein
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃
AA SequenceMGYERLGPSGATGSVTTSTTTAPILNQVSTSEQPENNNRRSKKKLVVSSIVLAISLILAAAIFAGVRSRLKLNQSVPGLARKPSQAISKACELTRFPELCVDSLMDFPGSLAASSSKDLIHVTVNMTLHHFSHALYSSASLSFVDMPPRARSAYDSCVELLDDSVDALSRALSSVVSSSAKPQDVTTWLSAALTNHDTCTEGFDGVDDGGVKDHMTAALQNLSELVSNCLAIFSASHDGDDFAGVPIQNRRLLGVEEREEKFPRWMRPKEREILEMPVSQIQADIIVSKDGNGTCKTISEAIKKAPQNSTRRIIIYVKAGRYEENNLKVGRKKINLMFVGDGKGKTVISGGKSIFDNITTTFHTASFAATGAGFIARDITFENWAGPAKHQAVALRIGADHAVIYRCNIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGNAAVVLQNCSIYARKPMDFQKNTITAQNRKDPNQNTGISIHASRVLAASDLQATNGSTQTYLGRPWKLFSRTVYMMSYIGGHVHTRGWLEWNTTFALDTLYYGEYLNSGPGSGLGQRVSWPGYRVINSTAEANRFTVAEFIYGSSWLPSTGVSFLAGLSI

Function and Role in Heat Tolerance

PME34 is essential for regulating guard cell wall flexibility, which is important for heat response in Arabidopsis . Null mutant alleles of PME34 display reduced thermotolerance . PME34 influences transpiration by controlling stomatal aperture via cell wall modification during heat stress . Expression of PME34 is induced by abscisic acid (ABA) and is highly expressed in guard cells . The PME34 mutation results in a defect in stomatal movement control and significantly alters PME and polygalacturonase activity, leading to a heat-sensitive phenotype . ABA signaling is required for proper PME34 expression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
PME34; ARATH34; At3g49220; F2K15.80; Probable pectinesterase/pectinesterase inhibitor 34 [Includes: Pectinesterase inhibitor 34; Pectin methylesterase inhibitor 34; Pectinesterase 34; PE 34; Pectin methylesterase 34; AtPME34]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PME34
Target Protein Sequence
MGYERLGPSGATGSVTTSTTTAPILNQVSTSEQPENNNRRSKKKLVVSSIVLAISLILAA AIFAGVRSRLKLNQSVPGLARKPSQAISKACELTRFPELCVDSLMDFPGSLAASSSKDLI HVTVNMTLHHFSHALYSSASLSFVDMPPRARSAYDSCVELLDDSVDALSRALSSVVSSSA KPQDVTTWLSAALTNHDTCTEGFDGVDDGGVKDHMTAALQNLSELVSNCLAIFSASHDGD DFAGVPIQNRRLLGVEEREEKFPRWMRPKEREILEMPVSQIQADIIVSKDGNGTCKTISE AIKKAPQNSTRRIIIYVKAGRYEENNLKVGRKKINLMFVGDGKGKTVISGGKSIFDNITT FHTASFAATGAGFIARDITFENWAGPAKHQAVALRIGADHAVIYRCNIIGYQDTLYVHSN RQFFRECDIYGTVDFIFGNAAVVLQNCSIYARKPMDFQKNTITAQNRKDPNQNTGISIHA SRVLAASDLQATNGSTQTYLGRPWKLFSRTVYMMSYIGGHVHTRGWLEWNTTFALDTLYY GEYLNSGPGSGLGQRVSWPGYRVINSTAEANRFTVAEFIYGSSWLPSTGVSFLAGLSI
Uniprot No.

Target Background

Function
This recombinant protein, Probable pectinesterase/pectinesterase inhibitor 34 (PME34) from *Arabidopsis thaliana*, functions in cell wall modification through the demethylesterification of pectin.
Gene References Into Functions
  1. At3g49220 (PME34) regulates transpiration by controlling stomatal aperture through its cell wall-modifying enzyme activity during heat shock response. PMID: 28381503
Database Links

KEGG: ath:AT3G49220

STRING: 3702.AT3G49220.1

UniGene: At.24776

Protein Families
PMEI family; Pectinesterase family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in siliques.

Q&A

What is PME34 and what is its functional significance in Arabidopsis thaliana?

PME34 (At3g49220) is a type I pectin methylesterase (PME) in Arabidopsis thaliana that catalyzes the demethylesterification of homogalacturonan (HG), a major pectic component of plant cell walls. PME34 contains a signal peptide with a transmembrane (TM) region (amino acids 46-66), a PME inhibitor (PMEI) domain (amino acids 81-232), predicted subtilisin-like protease processing basic motifs (amino acids 250-253 and 271-274), and a PME domain (amino acids 284-582) .

Functionally, PME34 plays a critical role in plant thermotolerance by regulating cell wall flexibility, particularly in guard cells. T-DNA insertion lines with null mutations in PME34 demonstrate reduced thermotolerance compared to wild-type plants, indicating its essential role in heat stress response . Interestingly, the thermotolerance impairment in pme34 mutants occurs independently of heat shock factor (HSF)-mediated transcriptional activation, suggesting PME34 functions through a distinct pathway in heat stress response .

PME34 is also involved in abscisic acid (ABA) signaling, as evidenced by its transcriptional induction following ABA treatment. Notably, PME34 expression is significantly impaired in the abi1-1 mutant (defective in ABA signaling) following both ABA treatment and heat stress, confirming that ABA signaling is required for proper PME34 expression .

How does PME34 contribute to heat tolerance in Arabidopsis thaliana?

PME34 contributes to heat tolerance through several interconnected mechanisms centered on cell wall modification and stomatal regulation:

  • Guard cell wall flexibility regulation: PME34 modifies pectin in guard cell walls, regulating their mechanical properties and enabling appropriate stomatal movement during heat stress . This flexibility is crucial for controlling transpiration rates and maintaining water balance under elevated temperatures.

  • PME and polygalacturonase activity modulation: PME34 mutations significantly alter PME and polygalacturonase activity, resulting in a heat-sensitive phenotype. These enzymatic activities are essential for appropriate cell wall remodeling during heat stress responses .

  • Stomatal aperture control: PME34 plays a crucial role in regulating transpiration through control of the stomatal aperture due to its cell wall-modifying enzyme activity. Proper stomatal function is vital during heat stress to balance water loss with gas exchange .

  • ABA response integration: PME34 transcription is induced by ABA, a key hormone in stress responses. This induction suggests PME34 participates in the ABA-mediated stress signaling pathway, which is central to heat stress adaptation .

The thermotolerance assays revealed that pme34 mutants showed substantially reduced survival (approximately 50% compared to wild-type Columbia plants) under acquired thermotolerance conditions, specifically when exposed to a heat stress regime of 1-hour 37°C sublethal heat stress, followed by 22°C recovery for 2 hours, and then 44°C lethal heat stress for 160 minutes .

What is the subcellular localization and structural organization of PME34?

PME34 exhibits a complex subcellular localization pattern and structural organization that directly relates to its function:

Subcellular Localization:

  • Plasma membrane association: PME34 initially localizes to the plasma membrane, as confirmed by colocalization studies using PME34-GFP (or GFP-PME34) fusion proteins with an mCherry-tagged plasma membrane marker (PM-RFP) in Arabidopsis protoplasts and onion epidermal cells .

  • Cell wall deposition: Following plasma membrane localization, PME34 becomes deposited in the cell wall matrix. This was demonstrated through plasmolysis analysis of onion epidermal cells treated with mannitol, which confirmed PME34 presence in the cell wall .

  • Topology determination: Fluorescence protease protection assays revealed that the transmembrane domain of PME34 is oriented such that it faces the extracellular space, making it sensitive to trypsin treatment when applied externally .

Structural Organization:
PME34 belongs to type I PMEs and contains several distinct domains:

  • Signal peptide with transmembrane region (amino acids 46-66)

  • PMEI domain (amino acids 81-232)

  • Subtilisin-like protease processing basic motifs (amino acids 250-253 and 271-274)

  • PME domain (amino acids 284-582)

The presence of both PME and PMEI domains in a single protein is characteristic of type I PMEs, which typically undergo post-translational processing that removes the PMEI domain before the mature PME becomes active. This structural organization allows for sophisticated regulation of PME activity and potentially enables auto-inhibition mechanisms before the protein reaches its destination in the cell wall .

What methodologies are recommended for studying PME34 enzymatic activity in plant tissues?

Studying PME34 enzymatic activity requires specialized methodologies that account for the protein's native environment and functional characteristics:

Gel Diffusion Assays:

  • Prepare citrus pectin (1% w/v) in 0.5% agarose gel with 12.5 mM citric acid/sodium phosphate buffer (pH 6.5)

  • Extract PME proteins from plant tissue using 1M NaCl and 20 mM Tris-HCl (pH 7.2)

  • Apply 20 μL of protein extract to wells in the gel

  • Incubate at 30°C for 16 hours

  • Stain the gel with 0.05% ruthenium red for 45 minutes

  • Measure the diameter of the stained halo, which corresponds to PME activity

Spectrophotometric Assays:

  • Extract PME proteins from plant tissue in extraction buffer (50 mM sodium phosphate, pH 7.5)

  • React 100 μL of extract with 900 μL of 0.5% (w/v) pectin in 0.1 M sodium phosphate buffer (pH 7.5)

  • Incubate the reaction at 30°C

  • Add alcohol oxidase to convert released methanol to formaldehyde

  • Add 0.02 M 2,4-pentanedione in 2 M ammonium acetate and 0.05 M acetic acid

  • Incubate at 60°C for 15 minutes

  • Measure absorbance at 412 nm

  • Calculate PME activity using a standard curve

Analysis of Pectin Methylesterification Status:

  • Prepare alcohol-insoluble residue (AIR) from plant tissues

  • Analyze pectin methylesterification using Fourier transform infrared spectroscopy (FTIR)

  • Quantify the degree of methylesterification (DM) by comparing the ratio of the area of the esterified carboxylic group peak (1740 cm⁻¹) to the sum of the areas of the esterified and non-esterified carboxylic groups (1740 and 1600 cm⁻¹, respectively)

Methanol Release Assays:

  • Collect plant tissues (e.g., guard cells isolated by enzymatic digestion)

  • Incubate tissue samples with purified PME34 or extracts from wild-type/mutant plants

  • Measure methanol release using gas chromatography-mass spectrometry (GC-MS)

  • Compare methanol release between wild-type and pme34 mutant tissues to evaluate PME34-specific activity

When studying PME34 specifically, researchers should conduct parallel experiments with pme34 null mutants as negative controls and complement these with recombinant PME34 expression to confirm enzyme specificity .

How does the interplay between PME34 and PME inhibitors (PMEIs) affect cell wall integrity during heat stress?

The dynamic interplay between PME34 and PME inhibitors (PMEIs) represents a sophisticated regulatory mechanism that directly influences cell wall integrity during heat stress through the following mechanisms:

Regulation of Pectin Methylesterification:

  • PME34 catalyzes the demethylesterification of homogalacturonan (HG) in the cell wall, while PMEIs counteract this activity

  • During heat stress, the precise balance of methylesterified vs. demethylesterified pectin is critical for maintaining appropriate cell wall elasticity and strength

  • Excessive PME activity without proper PMEI regulation can lead to increased calcium cross-linking of demethylesterified HG, resulting in cell wall rigidification and compromised heat tolerance

Stomatal Regulation During Heat Stress:

  • PME34 is highly expressed in guard cells and plays a crucial role in stomatal movement by modifying guard cell walls

  • PMEIs likely fine-tune PME34 activity in guard cells to ensure appropriate stomatal aperture control during heat stress

  • This regulation is essential for maintaining transpiration rates that balance water conservation with cooling effects during heat episodes

Stress Signaling Cascade:

  • The demethylesterification of pectin by PME34 releases methanol and potentially oligogalacturonides (OGs), which can act as damage-associated molecular patterns (DAMPs)

  • These signaling molecules can trigger defense responses and prepare neighboring cells for impending stress

  • PMEIs regulate the release of these signaling molecules by controlling PME activity, thereby modulating the stress response cascade

Molecular Evidence of Interaction:
PMEIs form a stoichiometric 1:1 complex with PMEs, as demonstrated by in vitro interaction studies at different pH values (pH 5.5-8.5) . The complex formation effectively inhibits PME activity, preventing excessive demethylesterification of pectin during stress conditions.

The importance of this PME-PMEI regulation is evident from studies of PMEI-overexpressing plants, which show:

  • Lower levels of PME activity

  • Higher degree of methylesterification (DME) of pectin

  • Enhanced resistance to certain pathogens

During heat stress, plants must maintain this delicate balance between PME34 activity and PMEI regulation to ensure cell wall properties that support thermotolerance while enabling necessary physiological adjustments such as stomatal movement .

What approaches help resolve conflicting data regarding PME34 function in different experimental systems?

Researchers investigating PME34 function may encounter conflicting data across different experimental systems. The following methodological approaches can help resolve such discrepancies:

Standardization of Genetic Materials:

  • Use multiple, well-characterized alleles of pme34 mutants (e.g., both pme34-1 and pme34-2 null mutants)

  • Include appropriate genetic controls in all experiments (wild-type Columbia, complementation lines)

  • Develop isogenic lines with tagged versions of PME34 (e.g., PME34-GFP) to ensure consistent protein tracking

  • Document the genetic background completely to account for potential modifier effects

Comprehensive Phenotypic Analysis:

  • Employ a range of thermotolerance assays testing both acquired and basal thermotolerance

    • Acquired: 1-h 37°C → 22°C recovery for 2 h → 44°C for 160 min

    • Basal: Direct exposure to 44°C without preconditioning

  • Quantify survival rates under standardized conditions (e.g., 50% reduced survival in pme34 mutants compared to wild-type)

  • Assess multiple physiological parameters including:

    • Stomatal conductance and aperture measurements

    • Water loss rates

    • Cell wall elasticity using atomic force microscopy

    • Calcium cross-linking patterns in the cell wall

Biochemical Activity Reconciliation:

  • Standardize PME extraction protocols (using identical buffers, salt concentrations, and pH)

  • Measure both total PME activity and PME34-specific activity using immunodepletion approaches

  • Assess activity across different developmental stages and tissue types

  • Consider the influence of post-translational modifications on enzyme activity

  • Evaluate PME and polygalacturonase activities concurrently as they often work together in cell wall modification

Environmental Condition Harmonization:

  • Precisely control and document growth conditions (temperature, light intensity, humidity)

  • Standardize the timing and duration of stress treatments

  • Consider circadian effects on PME34 expression and function

  • Account for plant age and developmental stage in all experiments

Multi-level Analysis Framework:

  • Integrate data from:

    • Transcriptomics (RNA-seq) to capture expression changes

    • Proteomics to identify interacting partners

    • Metabolomics to track cell wall composition changes

    • Immunolocalization to confirm protein localization patterns

  • Develop mathematical models to reconcile seemingly conflicting data points

Cross-validation with Related PMEs:

  • Compare PME34 function with other PMEs (e.g., PME28, which also shows thermotolerance defects)

  • Analyze double and triple mutants to identify functional redundancy

  • Use chimeric proteins with domains swapped between different PMEs to identify critical functional regions

By systematically implementing these approaches, researchers can develop a more comprehensive and accurate understanding of PME34 function across different experimental contexts, resolving apparent conflicts in the data and building a unified model of PME34's role in plant thermotolerance.

What expression systems are optimal for producing recombinant PME34 for functional studies?

Selecting the appropriate expression system for recombinant PME34 production is crucial for obtaining functional protein for biochemical and structural studies. Based on the complex domain structure and post-translational modifications required for PME34 activity, the following expression systems are recommended:

Plant-Based Expression Systems:

  • Nicotiana benthamiana Transient Expression

    • Methodology: Agrobacterium-mediated infiltration of PME34 constructs

    • Advantages: Maintains plant-specific post-translational modifications; proper folding environment; suitable for protein with complex domains

    • Protocol highlights:

      • Clone PME34 into pGWB vectors with appropriate tags (His, GFP, etc.)

      • Transform Agrobacterium tumefaciens strain GV3101

      • Infiltrate 4-6 week old N. benthamiana leaves

      • Harvest tissue 3-5 days post-infiltration

      • Extract protein using appropriate buffers (50 mM sodium phosphate, pH 7.5, with 150 mM NaCl)

    • Yield: Typically 5-10 mg PME34 per kg of leaf tissue

  • Arabidopsis Cell Suspension Cultures

    • Methodology: Stable transformation of Arabidopsis cell cultures

    • Advantages: Native processing machinery; maintains proper folding and processing of both PMEI and PME domains

    • Protocol highlights:

      • Transform Arabidopsis suspension cells with PME34 construct under inducible promoter

      • Induce expression and collect extracellular medium

      • Purify protein using affinity chromatography

    • Yield: 1-3 mg/L culture medium

Non-Plant Expression Systems:

  • Pichia pastoris Expression System

    • Methodology: Methanol-inducible expression

    • Advantages: Eukaryotic folding machinery; high yield; secreted protein; glycosylation capability

    • Protocol modifications for PME34:

      • Remove transmembrane domain for secretion

      • Use pPICZα vector with α-factor secretion signal

      • Transform P. pastoris strain X-33 or KM71

      • Induce with 0.5% methanol at 20°C for 72-96 hours

      • Purify from culture medium using ion exchange followed by size exclusion chromatography

    • Expected yield: 10-50 mg/L

  • Insect Cell Expression

    • Methodology: Baculovirus expression system

    • Advantages: Post-translational modifications; proper folding of complex proteins

    • Protocol highlights:

      • Clone PME34 into pFastBac vector

      • Generate bacmid and transfect Sf9 cells

      • Harvest recombinant protein 72-96 hours post-infection

      • Purify using affinity chromatography

    • Yield: 5-15 mg/L culture

Purification Strategy Comparison:

Expression SystemRecommended TagsBuffer ConditionsPurification StrategyActivity Retention
N. benthamianaC-terminal His650 mM Tris, pH 8.0, 150 mM NaClIMAC followed by IEX70-85%
A. thaliana cellsN-terminal StrepII50 mM sodium phosphate, pH 7.5StrepTactin affinity80-95%
P. pastorisC-terminal His650 mM sodium acetate, pH 5.5IMAC followed by SEC60-75%
Insect cellsN-terminal His6-MBP50 mM HEPES, pH 7.0, 100 mM NaClMBP affinity followed by tag cleavage65-80%

Critical Considerations for PME34 Expression:

  • Maintaining the signal peptide and PMEI domain is crucial for proper folding but may require optimization for each system

  • The transmembrane domain (amino acids 46-66) may need to be removed for efficient secretion in non-plant systems

  • Expression at lower temperatures (16-20°C) improves folding and activity

  • Include protease inhibitors during extraction to prevent degradation

  • Validate enzymatic activity of the recombinant protein against native PME34 extracted from Arabidopsis

For most research applications requiring functional studies of PME34 enzymatic activity, the Nicotiana benthamiana transient expression system offers the best compromise between yield and proper post-translational processing.

What molecular tools are available for studying PME34 function in Arabidopsis?

Researchers investigating PME34 function in Arabidopsis have access to a diverse toolkit of molecular techniques and resources that enable comprehensive functional characterization:

Genetic Resources:

  • T-DNA Insertion Lines:

    • pme34-1 and pme34-2 null mutants are available from the Arabidopsis Biological Resource Center (ABRC)

    • Both alleles show consistent thermotolerance defects, making them valuable negative controls

    • Additional PME mutant collections (53 homologous T-DNA insertion lines corresponding to 32 PME genes) can be used for comparative studies

  • Transgenic Reporter Lines:

    • PME34pro:GUS lines for tissue-specific expression analysis

    • PME34-GFP and GFP-PME34 fusions for subcellular localization studies

    • Inducible expression lines (estradiol or dexamethasone-inducible) for temporal control of PME34 expression

Molecular Imaging Tools:

  • Subcellular Localization Analysis:

    • Fluorescence tagging systems (PME34-GFP/GFP-PME34) for in vivo localization

    • PM-RFP (plasma membrane marker) for colocalization studies

    • Fluorescence protease protection assay for topology determination

    • Plasmolysis analysis using mannitol treatment to confirm cell wall deposition

  • Histochemical Analysis:

    • Ruthenium red staining for pectin visualization in situ

    • Immunohistochemical detection using JIM5 and JIM7 antibodies that recognize demethylesterified and methylesterified HG, respectively

    • Calcofluor white staining for observing cell wall structure alterations

Gene Expression Analysis:

  • Transcriptional Profiling:

    • RNA extraction protocols optimized for heat-stressed tissues

    • qRT-PCR primers specific for PME34 (At3g49220) and related genes

    • RNA-seq for genome-wide expression analysis during heat stress

    • Microarray data available through public repositories for comparative analysis

  • Promoter Analysis Tools:

    • PME34 promoter fragments for identifying heat- and ABA-responsive elements

    • Chromatin immunoprecipitation (ChIP) assays for identifying transcription factors binding to the PME34 promoter

    • Yeast one-hybrid screens to identify regulators of PME34 expression

Biochemical and Functional Assays:

  • PME Activity Measurement:

    • Gel diffusion assays using citrus pectin and ruthenium red staining

    • Spectrophotometric assays measuring methanol release

    • In situ PME activity visualization in plant tissues

  • Cell Wall Analysis:

    • FTIR spectroscopy for pectin methylesterification status

    • Atomic force microscopy for cell wall mechanical properties

    • Calcium imaging using specific dyes to visualize calcium cross-linking patterns

  • Physiological Phenotyping:

    • Thermotolerance assays (standardized heat treatment regimes)

    • Stomatal aperture measurements

    • Water loss rate determination

    • Thermal imaging for temperature regulation assessment

Protein-Protein Interaction Studies:

  • Interaction Analysis:

    • Yeast two-hybrid screens to identify PME34 interactors

    • Co-immunoprecipitation assays using PME34-specific antibodies or epitope tags

    • Bimolecular fluorescence complementation (BiFC) for in vivo interaction validation

    • Protein pull-down assays to identify PME34-PMEI interactions

CRISPR/Cas9 Genome Editing:

  • Precision Engineering:

    • CRISPR/Cas9 vectors targeting specific domains of PME34

    • Base editing for introducing point mutations in catalytic residues

    • Prime editing for precise modifications of PME34 regulatory elements

    • Multiplex editing for simultaneous modification of PME34 and related genes

These molecular tools can be strategically combined to develop a comprehensive understanding of PME34 function in Arabidopsis, particularly in the context of thermotolerance and cell wall modification during stress responses.

How can researchers effectively analyze PME34's role in heat stress signaling pathways?

Analyzing PME34's role in heat stress signaling pathways requires a multi-faceted experimental approach that integrates genetic, biochemical, and physiological methodologies:

Genetic Dissection Strategies:

  • Epistasis Analysis:

    • Generate double and triple mutants combining pme34 with mutations in:

      • Heat shock transcription factors (HSFs)

      • ABA signaling components (abi1-1, aba2-1)

      • Calcium signaling elements

      • Cell wall integrity sensors

    • Assess thermotolerance phenotypes to establish pathway hierarchies

    • Example experimental design:

      • Subject wild-type, single, and double mutants to acquired thermotolerance assay: 1-h 37°C → 22°C recovery for 2 h → 44°C for variable durations

      • Quantify survival rates and recovery dynamics

      • Statistically analyze genetic interactions (additive, synergistic, or epistatic effects)

  • Transcriptomic Network Analysis:

    • Perform RNA-seq on wild-type vs. pme34 mutants under:

      • Control conditions

      • Heat stress (37°C for 1 hour)

      • Recovery phase (2 hours post-stress)

    • Identify differentially expressed genes and enriched pathways

    • Construct gene regulatory networks to position PME34 within the heat stress transcriptome

    • Validate key interactions using qRT-PCR and chromatin immunoprecipitation

Biochemical Signal Transduction Analysis:

  • ABA Signaling Integration:

    • Quantify ABA levels in wild-type vs. pme34 tissues during heat stress

    • Measure PME34 expression in response to exogenous ABA application

    • Analyze expression patterns in wild-type vs. abi1-1 mutant under ABA treatment and heat stress

    • Monitor changes in stomatal conductance as a physiological readout of ABA response

  • Methanol and Oligogalacturonide Signaling:

    • Measure methanol release during heat stress in wild-type vs. pme34 plants

    • Assess neighboring cell responses to methanol using reporter constructs

    • Analyze oligogalacturonide (OG) production and profile their degree of methylesterification

    • Test transcriptional responses to purified OGs derived from wild-type vs. pme34 cell walls

Calcium Signaling Analysis:

  • Calcium Dynamics Visualization:

    • Transform wild-type and pme34 plants with GCaMP6 calcium sensors

    • Image calcium fluxes in real-time during heat stress

    • Quantify calcium oscillation patterns in guard cells

    • Correlate calcium dynamics with cell wall de-methylesterification patterns

    • Example protocol:

      • Culture plants on microscope-compatible chambers

      • Apply controlled heat stimulus while imaging

      • Analyze fluorescence intensity changes over time

      • Compare calcium signature between genotypes

Cell Wall Integrity Sensing:

  • Wall-Associated Kinase (WAK) Activation:

    • Analyze phosphorylation status of WAKs during heat stress

    • Compare WAK activation patterns in wild-type vs. pme34 mutants

    • Test PME34 and WAK interactions using co-immunoprecipitation

    • Investigate WAK-dependent gene expression in pme34 background

Systems Biology Integration:

  • Multi-omics Data Integration:

    • Combine transcriptomics, proteomics, metabolomics, and cell wall glycomics data

    • Develop computational models predicting PME34's role in heat stress signaling

    • Validate model predictions with targeted experiments

    • Experimental design example:

      • Collect tissue samples from wild-type and pme34 plants under:

        • Control conditions (22°C)

        • Early heat stress (37°C, 15 min)

        • Extended heat stress (37°C, 60 min)

        • Recovery phase (22°C, 2h post-stress)

      • Process parallel samples for RNA-seq, proteomics, and cell wall analysis

      • Integrate data using network analysis algorithms

Physiological Response Measurements:

  • Thermotolerance Assessment Framework:

    • Quantify survival rates under standardized stress conditions

    • Measure photosynthetic efficiency (Fv/Fm) during stress and recovery

    • Monitor reactive oxygen species (ROS) accumulation

    • Track membrane integrity changes (electrolyte leakage)

    • Assess stomatal responses during heat events

    • Document time-course of recovery from heat stress

ParameterWild-typepme34 mutantMeasurement Method
Survival rate after 44°C/160 min~100%~50%Visual scoring, chlorophyll fluorescence imaging
Stomatal conductance during heatDynamic reductionImpaired regulationInfrared gas analyzer, porometer
Cell wall PME activityNormal/increasedReducedGel diffusion assay, methanol release quantification
Calcium cross-linkingRegulated increaseDysregulatedImmunolocalization with calcium-pectin specific antibodies
ABA responsivenessRobustDiminishedStomatal aperture measurements, ABA-responsive gene expression

Through these integrated approaches, researchers can effectively position PME34 within the complex signaling networks that mediate heat stress responses, while distinguishing its unique contributions from those of other cell wall-modifying enzymes.

What approaches help distinguish PME34 functions from other PMEs in Arabidopsis?

Distinguishing the specific functions of PME34 from other PMEs in Arabidopsis presents a significant challenge given the large gene family (66 PME genes) with potential functional redundancy. The following methodological approaches can help researchers isolate PME34-specific functions:

Genetic Specificity Strategies:

  • Comparative Mutant Analysis:

    • Analyze multiple pme mutants side-by-side under identical conditions

    • Create a phenotypic profile matrix comparing pme34-1 and pme34-2 with other pme mutants (e.g., pme28, pme7)

    • Identify phenotypes unique to pme34 mutants versus shared phenotypes

    • Example of distinctive PME34 characteristics:

      • Heat sensitivity in acquired thermotolerance assays, but normal basal thermotolerance

      • Guard cell-specific functional defects

      • ABA-responsive expression patterns

  • Higher-Order Mutant Analysis:

    • Generate double, triple, and higher-order mutants combining pme34 with closely related PMEs

    • Quantify enhancement, suppression, or novel phenotypes in combined mutants

    • Use CRISPR/Cas9 multiplexing to target multiple PMEs simultaneously

Expression Pattern Differentiation:

  • High-Resolution Expression Mapping:

    • Compare tissue-specific and subcellular expression patterns using PME34pro:GUS versus other PMEpro:GUS reporters

    • Conduct single-cell transcriptomics focusing on guard cells and heat-responsive tissues

    • Develop a comprehensive expression atlas comparing all PMEs under various stress conditions

    • Key distinctive feature: PME34 shows strong expression in guard cells and is induced by ABA

  • Temporal Expression Analysis:

    • Monitor expression dynamics during:

      • Developmental stages

      • Diurnal cycles

      • Heat stress progression and recovery

      • ABA treatment time-course

    • Identify unique temporal expression signatures for PME34

Biochemical Characterization:

  • Substrate Specificity Analysis:

    • Compare catalytic properties of recombinant PME34 with other PMEs using:

      • Pectin substrates with varying degrees of methylesterification

      • Different pH and temperature profiles

      • Various divalent cation concentrations

    • Develop PME34-specific activity assays based on unique catalytic preferences

  • Protein-Protein Interaction Networks:

    • Perform comparative interactome analysis of PME34 versus other PMEs

    • Identify unique interaction partners specific to PME34

    • Use proximity labeling techniques (BioID or APEX) to map protein neighbors in native context

Domain Function Analysis:

  • Domain Swapping Experiments:

    • Create chimeric proteins exchanging domains between PME34 and other PMEs

    • Test functionality in pme34 complementation assays

    • Identify which domains confer PME34-specific functions

    • Example design:

      • Swap the PME catalytic domain, PMEI domain, or transmembrane region

      • Express in pme34 background

      • Test for restoration of thermotolerance and guard cell function

  • Structure-Function Analysis:

    • Compare predicted or experimental structural features of PME34 with other PMEs

    • Identify unique structural elements that could explain functional differences

    • Use site-directed mutagenesis to test the importance of PME34-specific residues

Cell Wall Modification Patterns:

  • Glycome Profiling:

    • Compare cell wall composition changes in pme34 versus other pme mutants

    • Use monoclonal antibody panels (e.g., CCRC series) to identify PME34-specific cell wall alterations

    • Analyze pattern of de-methylesterification (blockwise versus random) caused by PME34 versus other PMEs

  • Mechanical Property Assessment:

    • Measure cell wall mechanics in wild-type, pme34, and other pme mutants using:

      • Atomic force microscopy

      • Microindentation

      • Cell wall extensibility assays

    • Identify unique mechanical signatures associated with PME34 function

Signaling Pathway Integration:

  • Hormone Response Comparison:

    • Test sensitivity of multiple pme mutants to:

      • ABA (shown to specifically affect PME34 expression)

      • Ethylene

      • Jasmonic acid

      • Brassinosteroids

    • Map the hormone response network positions of different PMEs

    • Highlight PME34's unique position in ABA signaling

By systematically applying these approaches, researchers can build a PME34-specific functional profile that distinguishes its contributions from other members of the PME family, particularly in the context of heat stress response and guard cell function.

How can researchers address the challenges of studying cell wall dynamics during heat stress responses?

Studying cell wall dynamics during heat stress presents unique technical and biological challenges due to the rapid nature of stress responses and the complex composition of plant cell walls. The following methodological approaches can help researchers overcome these challenges:

Real-Time Visualization Approaches:

  • Live-Cell Imaging Techniques:

    • Use confocal microscopy with temperature-controlled chambers

    • Apply fluorescent probes for specific cell wall components:

      • Calcofluor white for cellulose

      • Propidium iodide for cell wall outlines

      • JIM5/JIM7 antibodies conjugated to fluorophores for differentially methylesterified pectins

    • Develop PME34-fluorescent protein fusions with maintained enzymatic activity

    • Implementation challenges and solutions:

      • Heat can affect fluorophore properties → Use heat-stable fluorescent proteins

      • Rapid cell movements during thermal expansion → Apply image registration algorithms

      • Temporal resolution limitations → Use spinning disk or light sheet microscopy

  • Biosensor Development:

    • Engineer FRET-based sensors for detecting:

      • Pectin methylesterification changes

      • Calcium cross-linking events

      • PME34 activity in situ

    • Create methylation-sensitive pectin-binding proteins linked to fluorescent reporters

    • Design cell wall pH sensors to track proton release during PME activity

Preserving Cell Wall Structures:

  • Cryofixation Techniques:

    • Apply high-pressure freezing to instantly preserve cell wall structure during heat stress

    • Use freeze substitution followed by resin embedding

    • Perform immunoelectron microscopy with gold-labeled antibodies against pectin epitopes

    • Advantages over chemical fixation:

      • Minimizes artifactual changes to cell wall structures

      • Preserves native distribution of cell wall components

      • Retains enzymatic reaction products

  • Non-Destructive Analysis Methods:

    • Implement Fourier Transform Infrared (FTIR) microspectroscopy for intact tissues

    • Apply Raman microscopy to track changes in cell wall chemistry with subcellular resolution

    • Use Atomic Force Microscopy (AFM) to measure mechanical properties during progressive heat stress

    • Conduct X-ray microdiffraction for detecting crystallinity changes in cell wall polymers

Temporal Resolution Enhancement:

  • Synchronized Sampling Strategies:

    • Develop rapid sampling devices for precisely timed collection during heat stress progression

    • Implement automated sampling platforms coordinated with temperature controllers

    • Create microfluidic devices for controlled heat application to plant tissues

    • Protocol outline:

      • Apply heat stress gradient (37°C to 44°C) with automated temperature controller

      • Collect samples at precise intervals (0, 5, 15, 30, 60, 120 min)

      • Flash-freeze in liquid nitrogen

      • Process parallel samples for different analyses (microscopy, biochemistry, transcriptomics)

  • Pulse-Chase Experiments:

    • Use isotope labeling (13C-glucose) to track newly synthesized cell wall components during heat stress

    • Apply click chemistry with functionalized sugars for tracing cell wall deposition

    • Measure incorporation rates of labeled precursors as indicators of cell wall metabolism

    • Track fate of methylester groups during heat-induced cell wall remodeling

Cell-Type Specific Analysis:

  • Single-Cell Type Isolation:

    • Use Fluorescence-Activated Cell Sorting (FACS) with PME34pro:GFP plants to isolate specific cells

    • Apply Laser Capture Microdissection for spatially resolved sampling

    • Implement INTACT (Isolation of Nuclei Tagged in specific Cell Types) method for cell-specific transcriptomics

    • Focus on guard cells where PME34 is highly expressed

  • Spatial Transcriptomics and Proteomics:

    • Apply in situ RNA sequencing techniques to maintain spatial context

    • Use MALDI imaging mass spectrometry for spatial proteomics

    • Implement spatial metabolomics to map cell wall precursors and breakdown products

    • Create 3D reconstructions of expression patterns in relation to cell wall modifications

Multi-Scale Integration:

  • Correlative Microscopy Approach:

    • Combine light, electron, and spectroscopic imaging of the same sample region

    • Example workflow:

      • Identify regions of interest with confocal microscopy

      • Apply micro-computed tomography for 3D context

      • Process for transmission electron microscopy with immunogold labeling

      • Correlate structural changes with PME34 localization and activity

  • Data Integration Framework:

    • Develop computational pipelines to integrate data across scales:

      • Molecular (gene expression, protein activity)

      • Subcellular (wall domains, plasma membrane interface)

      • Cellular (guard cell movement, wall elasticity)

      • Tissue (stomatal regulation, transpiration)

      • Whole plant (thermotolerance, water relations)

    • Apply machine learning to identify patterns in multi-dimensional datasets

ChallengeTechnical SolutionExamples from PME34 Research
Rapid cell wall changes during heatHigh-speed confocal imagingTracking PME34-GFP localization during heat stress
Distinguishing new vs. existing modificationsIsotope pulse labelingFollowing methyl group turnover during stress
Cell type heterogeneityGuard cell-specific isolationPME34 promoter-driven cell sorting
Preserving native wall structureCryofixationPreserving calcium cross-links in guard cell walls
Mechanical property changesAtomic force microscopyMeasuring guard cell wall elasticity in wild-type vs. pme34

By implementing these methodological approaches, researchers can overcome the significant challenges in studying cell wall dynamics during heat stress and gain deeper insights into PME34's specific roles in mediating thermotolerance through cell wall modification.

What are the most promising areas for future research on PME34 in plant stress biology?

The current understanding of PME34 function in plant stress biology opens several promising research frontiers that merit further investigation:

Integration of Multiple Stress Responses:

  • Cross-Stress Tolerance Mechanisms:

    • Investigate PME34's role in tolerance to combined stresses (heat+drought, heat+pathogen)

    • Examine how PME34-mediated cell wall modifications provide cross-protection against diverse stresses

    • Study the molecular basis for specificity in PME34's heat stress response versus other stresses

    • Research questions to explore:

      • Does PME34 function differentially under various abiotic stresses?

      • Can PME34 activity induced by one stress enhance tolerance to subsequent different stresses?

      • How does PME34 contribute to the stress memory phenomenon in plants?

  • Climate Change Adaptation Potential:

    • Assess PME34 allelic variation across Arabidopsis ecotypes from diverse climates

    • Evaluate how PME34 function contributes to local adaptation to heat-prone environments

    • Screen natural variation in PME34 for enhanced thermotolerance alleles

    • Develop predictive models linking PME34 variants to climate adaptation potential

Molecular Mechanisms and Regulation:

  • Post-Translational Regulation Dynamics:

    • Characterize the PME34 interactome during heat stress progression

    • Map phosphorylation, glycosylation, and other modifications affecting PME34 activity

    • Investigate the processing mechanisms that convert pro-PME34 to mature active enzyme

    • Identify regulatory proteins that directly modulate PME34 activity under stress

  • Spatial-Temporal Activity Control:

    • Develop methods to visualize and quantify PME34 activity with subcellular resolution

    • Investigate the mechanisms controlling PME34 plasma membrane localization and cell wall deposition

    • Study the turnover and recycling of PME34 during and after stress events

    • Map the microdomain organization of PME34 in the plasma membrane and cell wall

Signaling Networks:

  • Cell Wall Integrity Sensing Pathway:

    • Elucidate how PME34 activity connects to cell wall integrity sensing mechanisms

    • Identify downstream signaling components that respond to PME34-mediated wall modifications

    • Characterize the reciprocal regulation between PME34 and wall-associated kinases (WAKs)

    • Develop a comprehensive model of cell wall-to-nucleus signaling during heat stress

  • Calcium-PME34 Regulatory Circuit:

    • Investigate the relationship between calcium signaling and PME34 activity

    • Study how PME34-mediated de-methylesterification affects calcium cross-linking patterns

    • Examine the feedback between calcium cross-linking and further PME34 activation

    • Explore calcium-dependent PME inhibitor interactions with PME34

Functional Applications:

  • Crop Improvement Strategies:

    • Translate PME34 research from Arabidopsis to crop species

    • Identify functional orthologs of PME34 in major crops

    • Develop targeted modification of PME34 orthologs to enhance thermotolerance

    • Create high-resolution phenotyping methods to assess cell wall properties in crop breeding programs

  • Synthetic Biology Approaches:

    • Design synthetic PME34 variants with enhanced stability or activity

    • Create engineered regulatory circuits for dynamic control of PME34 expression

    • Develop chimeric PME34 proteins with novel substrate specificities or regulatory properties

    • Explore PME34 engineering for improved biomass properties and stress resilience

Systems-Level Integration:

  • Multi-Omics Integration Framework:

    • Combine transcriptomics, proteomics, metabolomics, and cell wall glycomics in PME34 studies

    • Develop predictive models of PME34 function across scales (molecular to whole plant)

    • Apply machine learning to identify patterns in large datasets related to PME34 function

    • Create digital twins of cell wall dynamics during stress for simulation studies

  • Evolutionary Perspectives:

    • Trace the evolutionary history of PME34 across plant lineages

    • Compare PME34 function in species with different heat adaptation strategies

    • Investigate functional divergence within the PME gene family

    • Connect PME evolution to changing climate conditions through evolutionary time

Emerging Technologies Application:

  • CRISPR Base Editing for Precise PME34 Modification:

    • Apply base editing to modify key residues in PME34 catalytic domain

    • Create allelic series with graduated effects on PME34 activity

    • Engineer improved PME34 variants with enhanced thermotolerance properties

    • Explore epigenetic regulation of PME34 using targeted epigenome editing

  • Single-Cell Resolution Analysis:

    • Implement single-cell transcriptomics to identify cell-specific PME34 responses

    • Apply spatial transcriptomics to map PME34 activity domains during stress

    • Develop cell-specific proteomics to characterize PME34 interactors in guard cells

    • Create multi-parameter single-cell phenotyping platforms for PME34 function assessment

These research directions represent high-potential areas that could significantly advance our understanding of PME34's role in plant stress biology while developing new approaches for enhancing crop resilience to climate change through cell wall engineering.

How might interdisciplinary approaches enhance our understanding of PME34 function?

Interdisciplinary approaches can significantly advance our understanding of PME34 function by integrating methodologies, concepts, and perspectives from diverse scientific fields:

Computational-Experimental Integration:

  • Structural Biology and Computational Modeling:

    • Apply protein structure prediction tools (AlphaFold2) to model PME34's three-dimensional structure

    • Perform molecular dynamics simulations to understand:

      • PME34 interactions with pectin substrates

      • Conformational changes during catalysis

      • Effects of mutations on protein stability and function

    • Use computational docking to predict interactions with PME inhibitors

    • Design guided mutagenesis experiments based on structural predictions

    • Potential outcomes:

      • Identification of catalytic residues specific to PME34 function

      • Rational design of PME34 variants with enhanced thermostability

      • Prediction of protein-protein interaction interfaces

  • Machine Learning for Image Analysis:

    • Develop deep learning algorithms to:

      • Automatically quantify cell wall properties from microscopy images

      • Track PME34-GFP localization dynamics in live cells

      • Classify cell wall phenotypes in wild-type versus mutant plants

    • Implement computer vision to analyze stomatal movement patterns

    • Create automated phenotyping pipelines for high-throughput screening

    • Example approach:

      • Train convolutional neural networks on labeled cell wall images

      • Apply transfer learning to adapt models across imaging modalities

      • Develop unsupervised clustering to identify novel wall phenotypes

Physical Sciences Integration:

  • Biophysics and Mechanobiology:

    • Characterize mechanical properties of cell walls modified by PME34 using:

      • Atomic force microscopy

      • Micro-indentation

      • Brillouin microscopy for non-contact mechanical mapping

    • Measure viscoelastic properties during heat stress progression

    • Correlate mechanical changes with PME34 activity patterns

    • Develop mathematical models of cell wall mechanics incorporating PME34 activity

    • Research questions to address:

      • How does PME34-mediated demethylesterification alter cell wall elasticity?

      • What mechanical thresholds trigger cell wall integrity sensing pathways?

      • How do mechanical properties influence stomatal opening dynamics?

  • Advanced Spectroscopy and Imaging:

    • Apply Förster resonance energy transfer (FRET) to monitor PME34-substrate interactions

    • Implement super-resolution microscopy (STORM, PALM) to visualize PME34 nanoscale organization

    • Use neutron scattering to characterize pectin network structure changes

    • Develop correlative light and electron microscopy workflows for multi-scale imaging

    • Potential discoveries:

      • Nanoscale organization of PME34 in cell wall microdomains

      • Dynamic interactions between PME34 and cell wall components

      • Structural rearrangements of pectin networks during stress

Chemical Biology Approaches:

  • Synthetic Chemistry and Chemical Biology:

    • Design activity-based probes for PME34 detection in complex environments

    • Develop fluorogenic substrates for real-time PME34 activity monitoring

    • Create photoactivatable PME inhibitors for spatiotemporal control of PME34 function

    • Synthesize modified pectin substrates to probe PME34 specificity

    • Experimental applications:

      • In situ mapping of active PME34 during heat stress progression

      • Optogenetic control of PME34 activity in specific cell types

      • High-resolution temporal analysis of PME34 activation dynamics

  • Metabolomics and Small Molecule Signaling:

    • Profile methanol and oligogalacturonide release during heat stress

    • Identify novel signaling molecules generated by PME34 activity

    • Investigate small molecule modulators of PME34 function

    • Develop targeted metabolomics approaches for cell wall breakdown products

    • Research questions:

      • Which specific oligogalacturonide patterns are generated by PME34?

      • How does methanol act as a signaling molecule during heat stress?

      • Are there undiscovered metabolites that regulate PME34 activity?

Systems Biology Integration:

  • Multi-Omics Data Integration:

    • Combine transcriptomics, proteomics, metabolomics, and glycomics data

    • Develop network models incorporating PME34 in the context of:

      • Heat stress response pathways

      • ABA signaling networks

      • Cell wall integrity sensing mechanisms

    • Apply causal inference methods to identify directional relationships

    • Create predictive models of PME34 function across scales

    • Implementation strategy:

      • Generate multi-omics data from wild-type and pme34 plants under heat stress

      • Apply network inference algorithms to identify key interactions

      • Validate model predictions with targeted experiments

  • Synthetic Biology and Circuit Design:

    • Engineer synthetic regulatory circuits controlling PME34 expression

    • Design feedback systems linking PME34 activity to cellular responses

    • Create biosensors for real-time monitoring of cell wall status

    • Develop orthogonal systems for precise control of PME34 function

    • Applications:

      • Engineered plants with enhanced thermotolerance mechanisms

      • Tunable PME34 expression systems for basic research

      • Synthetic cell wall remodeling programs for stress adaptation

Interdisciplinary Collaboration Framework:

DisciplineContributionExperimental ApproachExpected Outcome
Structural BiologyPME34 structure-function relationshipsX-ray crystallography, AlphaFold2 modelingCatalytic mechanism elucidation
BiophysicsCell wall mechanical property analysisAtomic force microscopy, rheologyPhysical basis of wall flexibility regulation
Machine LearningAutomated phenotyping and image analysisDeep learning, computer visionHigh-throughput phenotypic classification
Chemical BiologyPME34 activity probes and inhibitorsSynthetic chemistry, activity-based protein profilingSpatiotemporal control of PME34 function
Systems BiologyNetwork modeling and multi-omics integrationNetwork inference, causal modelingComprehensive stress response models
Synthetic BiologyEngineered PME34 circuitsDNA assembly, optogeneticsProgrammable cell wall properties

By leveraging these interdisciplinary approaches, researchers can develop a more comprehensive understanding of PME34 function that spans from molecular mechanisms to whole-plant physiology, ultimately providing deeper insights into plant stress adaptation and potential applications for crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.