Recombinant Arabidopsis thaliana Probable pectinesterase/pectinesterase inhibitor 61 (PME61)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
PME61; ARATH61; At5g53370; K19E1.17; Probable pectinesterase/pectinesterase inhibitor 61 [Includes: Pectinesterase inhibitor 61; Pectin methylesterase inhibitor 61; Pectinesterase 61; PE 61; AtPMEpcrF; Pectin methylesterase 61; AtPME61]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-587
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PME61
Target Protein Sequence
MGYDRLGPSGPSNPNQKDPATSLPELQKKTKTKLILFTLAVLVVGVVCFGIFAGIRAVDS GKTEPKLTRKPTQAISRTCSKSLYPNLCIDTLLDFPGSLTADENELIHISFNATLQKFSK ALYTSSTITYTQMPPRVRSAYDSCLELLDDSVDALTRALSSVVVVSGDESHSDVMTWLSS AMTNHDTCTDGFDEIEGQGGEVKDQVIGAVKDLSEMVSNCLAIFAGKVKDLSGVPVVNNR KLLGTEETEELPNWLKREDRELLGTPTSAIQADITVSKDGSGTFKTIAEAIKKAPEHSSR RFVIYVKAGRYEEENLKVGRKKTNLMFIGDGKGKTVITGGKSIADDLTTFHTATFAATGA GFIVRDMTFENYAGPAKHQAVALRVGGDHAVVYRCNIIGYQDALYVHSNRQFFRECEIYG TVDFIFGNAAVILQSCNIYARKPMAQQKITITAQNRKDPNQNTGISIHACKLLATPDLEA SKGSYPTYLGRPWKLYSRVVYMMSDMGDHIDPRGWLEWNGPFALDSLYYGEYMNKGLGSG IGQRVKWPGYHVITSTVEASKFTVAQFISGSSWLPSTGVSFFSGLSQ
Uniprot No.

Target Background

Function

This protein functions in cell wall modification through the demethylesterification of cell wall pectin.

Database Links

KEGG: ath:AT5G53370

STRING: 3702.AT5G53370.1

UniGene: At.24561

Protein Families
PMEI family; Pectinesterase family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in siliques, floral stems and rosettes leaves.

Q&A

What is PME61 and what are its structural characteristics?

PME61 (At5g53370) is a probable pectinesterase/pectinesterase inhibitor from Arabidopsis thaliana that functions in cell wall modification processes. Structurally, it's a protein of 587 amino acids with both pectinesterase and pectinesterase inhibitor domains . The protein contains a signal peptide that directs it to the cell wall, consistent with other pectin-modifying enzymes that function in the plant extracellular matrix. The amino acid sequence includes characteristic motifs of the pectinesterase family, including conserved aspartic acid, arginine, and lysine residues in the catalytic site that are essential for its enzymatic activity .

How does PME61 differ from other PMEs in Arabidopsis thaliana?

Arabidopsis thaliana contains multiple PME genes organized into five phylogenetic clades (groups A to E). PME61 belongs to a distinct group with both pectinesterase and inhibitor domains in a single protein . This dual functionality distinguishes it from other PMEs that lack inhibitor domains. While many PME family members show functional redundancy, research indicates that specific PMEs produce distinct patterns of pectin de-esterification that may be more relevant for particular biological functions than total PME activity . Compared to other characterized PMEs like PME3, PME12, PME17, and others mentioned in the literature, PME61 has unique expression patterns and potential specialized functions in plant development and stress responses .

What is the subcellular localization of PME61?

While direct localization studies specific to PME61 are not documented in the provided search results, research on related PMEIs provides valuable insights. For example, TaPMEI (wheat PMEI) subcellular localization was determined using a TaPMEI:GFP fusion construct transformed into onion epidermal cells by particle bombardment. The fluorescence signal was exclusively detected in the cell wall . Given the structural similarities and the presence of a signal peptide, PME61 is highly likely to be localized in the cell wall, which is consistent with its function in modifying cell wall pectins .

What are the optimal conditions for storing and handling recombinant PME61?

Recombinant PME61 should be stored in a Tris-based buffer with 50% glycerol at -20°C. For extended storage, conserving at -20°C or -80°C is recommended . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as it may compromise protein integrity and activity . When handling the protein, minimize exposure to temperatures above 4°C and avoid excessive agitation which can lead to denaturation. For experimental work, maintaining a consistent protocol for thawing and handling is critical to ensure reproducible results.

How can researchers measure PME61 activity in vitro and in planta?

For measuring PME activity in vitro, the gel diffusion assay is a standard method as demonstrated in studies with other PMEs . This approach involves:

  • Extraction of cytoplasmic and cell wall-bound proteins from homogenized plant samples

  • Incubating the extracted proteins with pectin substrate in an agarose gel

  • Staining with ruthenium red to visualize zones of de-esterified pectin

  • Quantifying activity by measuring the diameter of the stained areas

For in planta activity, researchers can:

  • Generate transgenic plants with altered PME61 expression (overexpression or knockout)

  • Measure changes in pectin methylesterification using techniques such as:

    • Immunolabeling with antibodies specific for different degrees of methylesterified pectins

    • Fourier-transform infrared spectroscopy (FTIR) to analyze cell wall composition

    • Quantification of methanol released during PME activity

Tracking changes in PME activity over time after pathogen challenge (e.g., every 24 hours for 4-5 days) can provide valuable information about the temporal dynamics of PME61 regulation .

What expression systems are most effective for producing recombinant PME61?

While specific expression systems for PME61 aren't detailed in the search results, the production of recombinant Arabidopsis PME61 indicates successful expression is possible . Based on related research with plant proteins:

Expression SystemAdvantagesChallenges
E. coliHigh yield, rapid growth, cost-effectiveMay lack proper folding and post-translational modifications
Yeast (P. pastoris)Eukaryotic folding machinery, glycosylationLonger production time than bacteria
Plant-based (N. benthamiana)Native-like modifications, proper foldingLower yields, more labor-intensive
Insect cell systemsEukaryotic processing, higher yieldsHigher cost, technically demanding

For optimal functional activity, expression systems that support proper protein folding and post-translational modifications should be prioritized, potentially making eukaryotic systems preferable despite their higher cost and complexity.

How is PME61 gene expression regulated under different developmental and stress conditions?

While direct information about PME61 expression regulation is limited in the search results, studies on related PME genes provide insights into potential regulatory mechanisms. PME genes show differential expression patterns in response to various stimuli:

  • Pathogen challenge: Several PME genes (PME12, PME17, At1g11580) are upregulated after inoculation with Pseudomonas syringae pv maculicola ES4326

  • Hormonal regulation: PME activity is induced by:

    • Jasmonic acid (JA) signaling pathway, which is essential for pathogen-induced PME activity

    • Salicylic acid (SA) treatments (as observed with TaPMEI)

  • Oxidative stress: Hydrogen peroxide treatments induce high transcription of PMEI genes

  • MAMP recognition: PME activity increases after treatment with the microbe-associated molecular patterns (MAMPs) flg22 and elf18

The regulation likely involves transcription factors such as ERF1, as overexpression of ERF1 promotes pathogen-induced PME activity . The MYC2 branch of JA signaling is required for bacterial pathogen-induced but not fungal pathogen-induced PME activity, indicating pathway specificity .

What biochemical factors influence PME61 enzymatic activity?

The enzymatic activity of PME61, like other PMEs, is influenced by several biochemical factors:

  • pH: PME activity is pH-dependent, with different pH optima affecting both the activity and the pattern of de-esterification

  • Ion concentration: Particularly calcium ions (Ca²⁺), which interact with de-esterified pectin to form egg-box structures that influence cell wall rigidity

  • Degree of pectin methylesterification: The substrate availability and accessibility impact enzyme kinetics

  • Presence of inhibitors: Endogenous PMEI domains or proteins can regulate activity through protein-protein interactions

  • Post-translational modifications: Potential phosphorylation, glycosylation, or other modifications may modulate activity

  • Protein-protein interactions: Interactions with other cell wall proteins can influence localized activity and substrate accessibility

Understanding these factors is crucial for designing experiments that accurately assess PME61 function both in vitro and in planta.

How does PME61 contribute to plant immunity against bacterial and fungal pathogens?

While specific evidence for PME61's role in immunity isn't directly provided in the search results, research on PMEs generally shows they play significant roles in plant defense mechanisms:

  • Cell wall fortification: PMEs modify pectin structure, potentially creating more rigid cell walls that act as physical barriers against pathogens

  • Pathogen-induced activity: Bacterial pathogens (P. syringae) and fungal pathogens (A. brassicicola) induce PME activity in Arabidopsis

  • Susceptibility phenotypes: Plants with mutations in various PME genes show increased susceptibility to bacterial pathogens, demonstrating their importance in defense responses

  • Defense signaling: PME activity is linked to JA signaling pathways critical for plant immunity

  • MAMP-triggered immunity: PME activity increases after treatment with MAMPs (flg22, elf18)

The specific pattern of pectin de-esterification produced by particular PMEs, potentially including PME61, may be more relevant for immunity than total PME activity levels . This suggests a highly specialized role for individual PMEs in tailoring the cell wall matrix for optimal defense responses.

What is the relationship between PME61 activity and hormone signaling during stress responses?

The relationship between PME activity and hormone signaling reveals complex regulatory networks:

  • Jasmonic acid (JA) dependency: Pathogen-induced PME activity is dependent on JA signaling

  • ERF1 branch: Overexpression of ERF1 (an ethylene response factor) promotes PME activity induced by either bacterial or fungal pathogens

  • MYC2 branch specificity:

    • Required for bacterial pathogen-induced PME activity

    • Not required for fungal pathogen-induced PME activity

  • Salicylic acid: High transcription of PMEI genes is detected after SA treatment

  • Reactive oxygen species: Hydrogen peroxide treatments induce PMEI expression

This evidence suggests a complex regulatory network where different stress response pathways converge on PME regulation but with pathway-specific effects depending on the stress type. While these findings aren't specific to PME61, they provide a framework for understanding how PME61 might be regulated during various stress responses.

How can genetic engineering of PME61 be used to enhance plant stress tolerance?

Based on the roles of PMEs in plant defense and stress responses, several strategies for genetic engineering of PME61 could be considered:

  • Controlled overexpression: Expressing PME61 under stress-inducible promoters could enhance cell wall fortification specifically during pathogen attack or abiotic stress conditions

  • Tissue-specific expression: Targeting PME61 expression to vulnerable tissues could provide localized protection without affecting normal development

  • Structure-function modifications:

    • Engineering the ratio of enzyme to inhibitor activity for optimized pectin modification

    • Site-directed mutagenesis to enhance specific activities or substrate preferences

  • Multi-gene approaches: Combining PME61 engineering with other defense-related genes for synergistic effects

  • CRISPR/Cas9 genome editing: Fine-tuning endogenous PME61 expression or activity through precise promoter or protein modifications

The effectiveness of these approaches would need to be evaluated through careful phenotypic analysis of transgenic plants under various stress conditions, with special attention to potential developmental trade-offs.

What methodological approaches can resolve conflicting data on PME61 function?

When researchers encounter conflicting data regarding PME61 function, several methodological approaches can help resolve these discrepancies:

  • Genetic redundancy analysis:

    • Create higher-order mutants by crossing pme61 with mutants of closely related PME genes

    • Use CRISPR/Cas9 to generate multiple knockouts simultaneously

    • This approach has proven valuable as shown by combining T-DNA insertions according to phylogenetic relationships of PME genes

  • Tissue-specific and temporal resolution:

    • Use cell-type specific promoters to express PME61 in different tissues

    • Employ inducible systems to control timing of expression

    • These approaches can reveal context-dependent functions

  • Biochemical characterization:

    • Compare enzymatic properties using standardized substrates and conditions

    • Conduct detailed analysis of pectin methylesterification patterns rather than just total activity

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data to build comprehensive models

    • Analyze cell wall compositional changes using methods like FTIR

  • Evolutionary analysis:

    • Compare functions across species to identify conserved and divergent roles

    • Study natural genetic variation in PME response as demonstrated in Arabidopsis accessions

How do PME61 interactions with other cell wall proteins contribute to cell wall remodeling during development and stress?

The complex protein interaction network in the plant cell wall is critical for coordinated cell wall remodeling:

  • Potential protein interaction partners:

    • Other PMEs and PMEIs for coordinated pectin modification

    • Polygalacturonases that cleave de-esterified pectin

    • Expansins that facilitate cell wall loosening

    • Peroxidases involved in cross-linking cell wall components

  • Spatiotemporal coordination:

    • PME activity must be coordinated with other cell wall modifying enzymes

    • Local pH changes created by PME activity can affect the activity of other enzymes

  • Signaling cascades:

    • Cell wall integrity sensing mechanisms may detect changes in pectin status

    • Receptor-like kinases that span the plasma membrane can transduce signals from the cell wall to the cytoplasm

  • Mechanical feedback:

    • Changes in cell wall mechanics due to PME61 activity may trigger mechano-sensitive channels

    • This could create feedback loops affecting gene expression of other cell wall proteins

Research approaches to investigate these interactions could include co-immunoprecipitation studies, yeast two-hybrid screening, bimolecular fluorescence complementation, and proteomics analysis of cell wall fractions under different developmental and stress conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.