Recombinant Arabidopsis thaliana Probable pectinesterase/pectinesterase inhibitor 64 (PME64)

Shipped with Ice Packs
In Stock

Description

Introduction

Arabidopsis thaliana, commonly known as thale cress, serves as a pivotal model organism in plant biology, offering extensive genetic and genomic resources that have significantly advanced our understanding of plant development, molecular biology, and responses to environmental stress . Within Arabidopsis thaliana, PME64, or Probable Pectinesterase/Pectinesterase Inhibitor 64, is categorized as a proteinaceous inhibitor of pectin methylesterases (PMEs) . PMEs play a crucial role in plant development by influencing the mechanical properties of the plant cell wall .

Pectin Methylesterases (PMEs) and PME Inhibitors (PMEIs)

Pectin methylesterases (PMEs) are enzymes that modify the degree of methylesterification of homogalacturonans (HGs), which are major components of pectin in Arabidopsis thaliana . The activity of PMEs can be regulated through interaction with PME inhibitors (PMEIs) and subtilases (SBTs) . PMEIs are proteins that inhibit the activity of PMEs, thereby controlling pectin esterification .

Function and Significance of PME64

PME64 is a specific PMEI found in Arabidopsis thaliana. Research indicates that PME64, along with other PMEIs, interacts with and inhibits plant-derived PMEs but not microbial enzymes . The expression of PMEIs, including PME64, is tightly regulated during plant development, with the highest mRNA levels found in flowers, particularly in pollen . This suggests that PME64 plays a critical role in pollen development and function .

Impact on Plant Development and Cell Wall Properties

The activity of PMEs and their inhibition by PMEIs like PME64 influence the mechanical properties of the plant cell wall, which is essential for various developmental processes . By controlling the degree of pectin methylesterification, PME64 helps to fine-tune cell wall rheology and plant development .

Recombinant Production and Research Applications

Recombinant PME64 can be produced using Arabidopsis-based super-expression systems, which allow for the production of homologous recombinant proteins . Such systems enable the study of protein structure and function and are suitable for biochemical and structural studies .

PME64 in the Broader Context of Plant Research

Arabidopsis thaliana is a widely used model for developmental and molecular plant biology . Study of Arabidopsis has revealed the existence of orthologs to human disease genes, with a high degree of similarity . The simplicity of Arabidopsis's G protein repertoire, when compared to other multicellular model systems, has allowed breakthrough in G protein research . Research into Arabidopsis is also improving our understanding of the function of plant peroxisomes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
PME64; ARATH64; At5g64640; MUB3.16; Probable pectinesterase/pectinesterase inhibitor 64 [Includes: Pectinesterase inhibitor 64; Pectin methylesterase inhibitor 64; Pectinesterase 64; PE 64; Pectin methylesterase 64; AtPME64]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-602
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PME64
Target Protein Sequence
MDSPTLPHSISASSSTPFASAAVKPHRNKLLSRNGILIIIAASCILLLLISLLIYATVSK SSRNHHNPSHQTPTSDDHPPPETPPSPPPIAQIRLACNATRFPDHCVASLSKPGQVPPDP KPVQIIHSAISVSYENLKSGQSKIQSILDSSAGNRNRTNIATICLEILSYSQHRTESTDI AVTSGDIKDARAWMSAALAYQFDCWSGLKTVNDTKQVVDTITFFEGLVNLTGNALSMMLS FDSFGDDVVSWIRPATERDGFWEKAGPSLGSGTGTEASLGFPSGLTEDVTVCKNGGKDCK YKTVQEAVDSAPDTNRTVKFVIRIREGVYEETVRVPFEKKNVVFIGDGMGKTVITGSLNV GQPGMTTFESATVGVLGDGFMARDLTIENTAGADAHQAVAFRSDSDFSVLENCEFLGNQD TLYAHSLRQFYKQCRIQGNVDFIFGNSAAVFQDCDILIASKHSKLEQGGANNAITAHGRI DASQSTGFVFLNCSINGTEEYMKEFQANPEGHKNFLGRPWKEFSRTVFVNCNLESLISPD GWMPWNGDFALKTLYYGEYKNTGPGSVRSSRVPWSSEIPEKHVDVYSVANFIQADEWAST TA
Uniprot No.

Target Background

Function

Function: Involved in cell wall modification through the demethylesterification of cell wall pectin.

Database Links

KEGG: ath:AT5G64640

STRING: 3702.AT5G64640.1

UniGene: At.28947

Protein Families
PMEI family; Pectinesterase family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in siliques.

Q&A

What is PME64 and what is its basic molecular characterization?

PME64 (At5g64640, also annotated as MUB3.16) is a probable pectinesterase/pectinesterase inhibitor in Arabidopsis thaliana. It belongs to a large family of pectin methylesterases (PMEs) that catalyze the demethylesterification of homogalacturonans in plant cell walls. The full-length protein consists of 602 amino acids and contains both a PME catalytic domain and a PME inhibitor domain .

The protein characteristics include:

  • Molecular weight: ~66 kDa (predicted from 602 amino acids)

  • Gene location: Chromosome 5 of Arabidopsis thaliana

  • UniProt accession: Q8L7Q7

How does PME64 fit within the broader PME family in Arabidopsis?

Arabidopsis thaliana contains 66 PME genes, suggesting extensive genetic redundancy in this family . PMEs catalyze the removal of methyl groups from pectin, which affects cell wall properties including rigidity, porosity, and adhesion. While the specific function of PME64 has not been fully characterized in the available literature, PMEs generally play crucial roles in various physiological processes including cell growth, pollen tube development, and responses to pathogens .

FeaturePME Family in Arabidopsis
Number of genes66 total PME genes
Functional classesCatalytic PMEs and PME inhibitors
Role in immunityMultiple PMEs contribute to pathogen resistance
RegulationOften regulated by jasmonic acid and ethylene signaling

What expression systems are optimal for producing recombinant PME64?

Based on commercial product information, recombinant full-length PME64 can be successfully expressed in E. coli with an N-terminal His-tag . The protein can be expressed as the complete sequence (amino acids 1-602) and purified to >90% purity using standard affinity chromatography techniques.

Recommended expression protocol includes:

  • Express full-length protein with N-terminal His-tag in E. coli

  • Purify using immobilized metal affinity chromatography (IMAC)

  • Lyophilize in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol (final concentration 5-50%) for long-term storage

Alternative expression systems might include yeast or insect cells if post-translational modifications are required for full activity.

How can PME64 activity be measured in experimental settings?

While specific assays for PME64 are not detailed in the search results, standard methods for measuring PME activity include:

  • Gel diffusion assay:

    • Pectin substrate incorporated into agarose gel

    • PME activity visualized with ruthenium red staining

    • Quantified by measuring the area of stained region

  • Spectrophotometric assays:

    • Continuous measurement of proton release during demethylesterification

    • Can be coupled with pH indicators or alcohol oxidase

For sample preparation, proteins can be extracted from homogenized plant samples, separating cytoplasmic and cell wall-bound fractions to measure PME activity in different cellular compartments .

How does PME64 contribute to plant defense responses?

While the specific role of PME64 in immunity is not detailed in the search results, PMEs in general contribute significantly to plant defense. Studies have shown that selected PME mutants allowed more growth of Pseudomonas syringae pv maculicola ES4326 (Pma ES4326) than wild-type plants, indicating a role of PMEs in resistance to this pathogen .

Importantly, PME activity increases in Arabidopsis after challenge by pathogens:

  • PME activity increases beginning 48 hours after infection with Alternaria brassicicola

  • Similar increases occur 48 hours after inoculation with Pma ES4326

  • Elevated PME activity is also detected after treatment with the microbe-associated molecular patterns (MAMPs) flg22 and elf18

These findings suggest that PME64, as a member of the PME family, may participate in the plant immune response through modification of cell wall structure.

What molecular mechanisms regulate PME64 activity during immune responses?

The pathogen-induced PME activity in Arabidopsis is dependent on specific signaling pathways:

  • Jasmonic acid (JA) signaling:

    • Pathogen-induced PME activity requires JA signaling

    • For Alternaria brassicicola-induced PME activity, the ethylene response factor (ERF) branch of JA signaling contributes to induction

    • For Pma ES4326-induced PME activity, both the ERF and MYC2 branches of JA signaling contribute

  • Independence from other hormone pathways:

    • Pathogen-induced PME activity does not require salicylic acid signaling

    • PME activity is also independent of ethylene signaling

These regulatory mechanisms suggest that PME64 expression and activity may be controlled by similar pathways during pathogen challenge.

What genetic approaches are most effective for studying PME64 function in planta?

Several genetic approaches can be employed to study PME64 function:

  • Loss-of-function studies:

    • T-DNA insertion mutants or CRISPR-Cas9 generated knockouts

    • RNAi or artificial microRNA approaches for conditional knockdown

    • Analysis of developmental phenotypes and pathogen susceptibility

  • Gain-of-function studies:

    • Overexpression using constitutive (35S) or tissue-specific promoters

    • Inducible expression systems to control timing of PME64 activity

    • Complementation of mutant phenotypes with wild-type or modified PME64

  • Reporter gene fusions:

    • Promoter-GUS fusions to study expression patterns

    • Protein-fluorescent protein fusions to examine subcellular localization

The search results indicate that single, double, triple, and quadruple PME mutants have been studied, with some showing increased susceptibility to Pma ES4326 . Interestingly, these mutants did not show decreases in total PME activity, suggesting that specific patterns of pectin methylesterification, rather than total PME activity, may be more important for immunity .

What are the key biochemical properties of recombinant PME64?

Based on the available information about PME64 and other plant PMEs, key biochemical properties to consider include:

PropertyExpected CharacteristicsExperimental Approach
Optimal pHTypically 6-8 for plant PMEsActivity assays across pH range
Temperature stabilityStorage at -20°C/-80°C recommended Thermal shift assays
Substrate specificityHomogalacturonans with varying degrees of methylationModified gel diffusion assays
Inhibitor sensitivityMay be regulated by endogenous PMEIsInhibition assays
Cofactor requirementsSome PMEs require Ca²⁺ for optimal activityActivity assays with/without ions

The recombinant PME64 is reported to be stable in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 , suggesting this may be near its optimal pH for stability if not activity.

How does PME64 structure relate to its function in cell wall modification?

While specific structural information about PME64 is not provided in the search results, general structure-function relationships in PMEs suggest:

  • Catalytic domain features:

    • Conserved active site residues for demethylesterification

    • Substrate binding cleft that accommodates homogalacturonan chains

    • Potential calcium binding sites for structural stability or catalysis

  • PMEI domain characteristics:

    • May regulate enzyme activity through intramolecular interactions

    • Could be processed during protein maturation

    • May influence substrate specificity or interaction with cell wall components

The specific pattern of demethylesterification catalyzed by PME64 would determine its effect on cell wall properties. PMEs can act in a processional manner (creating blocks of demethylesterified residues) or a random manner, with different consequences for pectin cross-linking and cell wall mechanics.

How has genomic analysis contributed to our understanding of PME64?

Genome-wide studies of Arabidopsis have provided context for understanding PME64:

  • Recombination patterns:

    • Arabidopsis shows enrichment of recombination hotspots in intergenic regions and repetitive DNA

    • This pattern is similar to humans but differs from other plant species like maize and wheat

    • Microsatellites play a fundamental role in meiotic recombination in Arabidopsis

  • Gene family organization:

    • The 66 PME genes in Arabidopsis suggest extensive genetic redundancy

    • This redundancy explains why single mutants often show subtle phenotypes

    • Comparative genomics can reveal conserved and diversified PME functions

These genomic findings provide important context for designing experiments to study PME64, particularly when considering genetic approaches that might be affected by functional redundancy.

What evolutionary insights can be gained from studying PME64?

While specific evolutionary information about PME64 is not provided in the search results, evolutionary analyses of PMEs could reveal:

  • Gene duplication patterns:

    • When PME64 arose during Arabidopsis evolution

    • Whether it has undergone subfunctionalization or neofunctionalization

  • Selection pressures:

    • Evidence for positive selection that might indicate adaptation

    • Conserved residues that might be functionally critical

  • Comparative genomics:

    • Orthologs in other species that might share conserved functions

    • Species-specific adaptations in PME structure and function

The search results indicate that genomic mapping resources for Arabidopsis include a Regional Mapping (RegMap) panel of 1,307 worldwide accessions genotyped at 250K SNPs . This resource could be valuable for studying natural variation in PME64 and identifying potential adaptive changes across different environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.