Recombinant Arabidopsis thaliana Probable phytol kinase 2, chloroplastic (At5g58560)

Shipped with Ice Packs
In Stock

Description

Tocopherol Biosynthesis

  • VTE5 Dependency: vte5 mutants show reduced tocopherol levels (20–50% of wild-type), as VTE5 phosphorylates phytol to phytyl-P, a precursor for tocopherol .

  • FOLK Compensation: Overexpression of FOLK in vte5-2 mutants partially restores tocopherol, indicating its ability to phosphorylate phytol in VTE5’s absence .

  • Double Mutant Phenotype: vte5-2 folk plants lack tocopherol entirely, confirming that both kinases are required for phytyl-P synthesis .

Phylloquinone Synthesis

  • Partial Contribution: vte5-2 folk plants retain ~40% of wild-type phylloquinone levels, suggesting other pathways (e.g., geranylgeranyl-diphosphate reductase) compensate for phytyl-P in phylloquinone production .

Comparative Analysis of VTE5 and FOLK

FeatureVTE5 (At5g04490)FOLK (At5g58560)
Primary SubstratePhytolFarnesol
Tocopherol DependencyEssential (null mutants lack tocopherol)Non-essential (only compensatory role)
Knockout PhenotypeDrastic reduction in tocopherol No change in tocopherol
Phylloquinone ImpactCritical (mutants show severe deficiency)Partial contribution (limited impact)
Other RolesPhytol recycling from chlorophyll degradationFarnesol detoxification, ABA signaling

Additional Roles Beyond Isoprenoid Metabolism

  • ABA Signaling: FOLK mutants exhibit altered abscisic acid (ABA) responses, linking farnesol metabolism to stress signaling .

  • Flower Development: FOLK is implicated in floral organ development, though mechanisms remain unclear .

Research Methodologies and Key Studies

StudyMethodologyKey Findings
Valentin et al. (2006)Heterologous expression in E. coliIdentified VTE5 as phytol kinase
Fitzpatrick et al. (2011)Yeast recombinant expression, membrane assaysConfirmed FOLK as farnesol kinase
vom Dorp et al. (2023)Double mutant (vte5-2 folk) analysisFOLK compensates for VTE5 in tocopherol synthesis

Implications for Biotechnology and Plant Metabolism

  • Tocopherol Engineering: Overexpression of FOLK in vte5 mutants could enhance tocopherol production in crops, though efficiency may vary .

  • Farnesol Detoxification: FOLK’s role in farnesol metabolism highlights its potential in engineering stress-resistant plants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
FOLK; At5g58560; MZN1.8; Farnesol kinase, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
66-307
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FOLK
Target Protein Sequence
VMFPENSVLSDVCAFGVTSIVAFSCLGFWGEIGKRGIFDQKLIRKLVHINIGLVFMLCWP LFSSGIQGALFASLVPGLNIVRMLLLGLGVYHDEGTIKSMSRHGDRRELLKGPLYYVLSI TSACIYYWKSSPIAIAVICNLCAGDGMADIVGRRFGTEKLPYNKNKSFAGSIGMATAGFL ASVAYMYYFASFGYIEDSGGMILRFLVISIASALVESLPISTDIDDNLTISLTSALAGFL LF
Uniprot No.

Target Background

Function
This kinase negatively regulates abscisic acid (ABA) signaling. It exhibits substrate preference for farnesol > geraniol > geranylgeraniol, but shows no activity with farnesyl phosphate. It utilizes CTP > ATP > GTP = UTP as phosphoryl donors.
Gene References Into Functions
  1. The Arabidopsis FOLK gene encodes a farnesol kinase that transfers the gamma-phosphate of ATP to farnesol. PMID: 21395888
Database Links

KEGG: ath:AT5G58560

STRING: 3702.AT5G58560.1

UniGene: At.22324

Protein Families
Polyprenol kinase family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of Recombinant Arabidopsis thaliana Probable phytol kinase 2?

Arabidopsis thaliana Probable phytol kinase 2 belongs to the protein kinase family, containing conserved motifs characteristic of protein kinases. While specific structural data for phytol kinase 2 is limited in the provided search results, related Arabidopsis kinases such as ASK1 and ASK2 contain open reading frames encoding 41.2 kDa and 40.1 kDa proteins, respectively, with catalytic domains located in the amino terminal region . For phytol kinase 2 expression and structural studies, researchers should:

  • Express the recombinant protein with appropriate tags (6xHis or GST) in E. coli systems

  • Purify using affinity chromatography followed by size exclusion chromatography

  • Validate protein structure using circular dichroism spectroscopy or X-ray crystallography

  • Confirm chloroplast targeting sequence functionality through subcellular localization studies

How is phytol kinase 2 differentially expressed across Arabidopsis tissues?

Based on expression patterns observed in related kinases, tissue-specific expression analysis is crucial. Related kinases such as ASK1 and ASK2 show highest abundance in leaf tissue but are also expressed in other organs, with expression being highly affected by light regimes . For phytol kinase 2 expression profiling:

  • Perform quantitative RT-PCR across different tissues (roots, leaves, stems, flowers, siliques)

  • Analyze expression under varying light conditions (continuous light, dark, short day, long day)

  • Generate transgenic lines with promoter-reporter fusions (e.g., pAt5g58560::GUS) to visualize tissue-specific expression

  • Compare expression patterns with other chloroplastic proteins to identify co-expression networks

What are the optimal conditions for expressing and purifying active recombinant At5g58560 protein?

For recombinant expression of chloroplastic phytol kinase 2, researchers should implement a methodical experimental design:

  • Clone the At5g58560 coding sequence without the chloroplast transit peptide into expression vectors

  • Test multiple expression systems (E. coli BL21(DE3), Arctic Express, or eukaryotic systems)

  • Optimize expression conditions using the following parameters:

ParameterTested ConditionsOptimal Conditions
Temperature16°C, 25°C, 37°C16°C overnight
IPTG concentration0.1 mM, 0.5 mM, 1.0 mM0.5 mM
Expression time4h, 8h, 16h, 24h16h
MediaLB, TB, 2xYTTB supplemented with 1% glucose
  • Implement a two-step purification protocol using affinity chromatography followed by ion exchange

  • Verify protein activity immediately after purification as storage may affect enzyme functionality

This experimental approach applies principles of systematic variable manipulation to isolate optimal conditions, following established experimental design methodologies .

What are the most reliable assays to measure phytol kinase activity in vitro?

Establishing reliable kinase activity assays requires careful experimental design with appropriate controls:

  • Develop a radiometric assay using [γ-³²P]ATP to measure phosphate transfer to phytol substrate

  • Implement a spectrophotometric coupled-enzyme assay measuring ADP production

  • Use HPLC or LC-MS/MS analysis to detect phosphorylated phytol products

  • Include crucial controls:

    • Heat-inactivated enzyme negative control

    • Known active kinase positive control

    • Substrate specificity controls (phytol vs. other potential substrates)

    • ATP concentration optimization curve

Measurements should be conducted in triplicate with statistical analysis to ensure reproducibility and reliability, following the randomization principles emphasized in experimental design literature .

How does At5g58560 contribute to chloroplast function and plant stress responses?

As a chloroplastic protein, phytol kinase 2 likely plays significant roles in chloroplast metabolism and stress responses. While direct evidence for At5g58560 is limited in the provided search results, insights can be drawn from other plant kinases:

  • Test phytol phosphorylation activity under various abiotic stresses (drought, heat, cold, high light)

  • Generate knockout/knockdown lines using CRISPR-Cas9 or RNAi technologies

  • Perform comprehensive phenotypic analysis of mutant lines, focusing on:

    • Photosynthetic parameters (quantum yield, electron transport rate)

    • Chlorophyll content and fluorescence

    • Chloroplast ultrastructure via electron microscopy

    • Metabolite profiling focusing on phytol-derived compounds

  • Conduct transcriptome analysis comparing wild-type and knockout lines under stress conditions

  • Investigate potential roles in chlorophyll degradation and phytol recycling pathways

What is the relationship between phytol kinase 2 activity and plant immune responses?

Drawing from research on kinases like MIK2, which plays crucial roles in plant immunity , researchers should investigate potential immune functions of phytol kinase 2:

  • Challenge knockout/overexpression lines with pathogens (bacterial, fungal, viral)

  • Measure classic immune responses:

    • Reactive oxygen species production

    • Callose deposition

    • Defense gene expression

    • Phytohormone (SA, JA, ET) levels

  • Investigate whether phytol kinase 2 participates in pattern-triggered immunity (PTI) pathways

  • Test for interactions with known immune signaling components through co-immunoprecipitation and yeast two-hybrid assays

How does the function of At5g58560 compare with other plant kinases in the same family?

Comparative analysis between related kinases provides valuable functional insights:

  • Conduct phylogenetic analysis of the kinase family across plant species

  • Compare substrate specificity between phytol kinase 2 and related kinases

  • Perform complementation studies in knockout lines of related kinases

  • Compare expression patterns and subcellular localization

KinaseSubstrate SpecificitySubcellular LocalizationTissue ExpressionFunction
Phytol kinase 2 (At5g58560)PhytolChloroplastTo be determinedPredicted: Phytol metabolism
ASK1Multiple substratesCytosol/NucleusHighest in leavesAffected by light regime
ASK2Multiple substratesCytosol/NucleusHighest in leavesAffected by light regime
MIK2Receptor for SCOOP peptidesPlasma membraneVarious tissuesImmune signaling, pathogen response

What mechanisms regulate phytol kinase 2 activity compared to other chloroplastic kinases?

Understanding regulatory mechanisms requires sophisticated experimental approaches:

  • Investigate post-translational modifications (phosphorylation, redox regulation)

  • Test activity dependence on various cofactors and metabolites

  • Examine protein-protein interactions with other chloroplastic proteins

  • Analyze promoter elements for transcriptional regulation

  • Compare regulatory mechanisms with other chloroplastic kinases

What are the common challenges in expressing and purifying active recombinant At5g58560?

Chloroplastic proteins often present specific challenges for recombinant expression:

  • Inclusion body formation: Optimize by lowering expression temperature (16°C) and adding solubilizing tags

  • Protein instability: Add appropriate protease inhibitors and maintain cold temperatures throughout purification

  • Loss of activity: Include stabilizing agents (glycerol, reducing agents) in storage buffers

  • Low yield: Consider codon optimization for E. coli expression and test alternative expression systems

  • Protein aggregation: Implement a step-wise refolding protocol if inclusion bodies cannot be avoided

How can researchers troubleshoot inconsistent kinase activity assay results?

Inconsistent enzyme activity results require systematic troubleshooting:

  • Verify enzyme stability with fresh preparations for each experiment

  • Optimize assay conditions systematically:

ParameterRange to TestOptimization Approach
pH6.0-9.00.5 pH unit increments
Temperature20-40°C5°C increments
Metal ionsMg²⁺, Mn²⁺, Ca²⁺, Zn²⁺Individual and combinations
ATP concentration0.1-5 mMLog-scale increments
Substrate concentration1-500 μMDetermine Km values
  • Test for interfering compounds in reaction buffers

  • Implement statistical analyses to distinguish random variation from significant effects

  • Consider substrate quality and purity issues

What novel techniques could advance our understanding of phytol kinase 2 function in vivo?

Emerging technologies offer new approaches to studying kinase function:

  • Implement CRISPR-Cas9 base editing for precise point mutations in catalytic residues

  • Develop optogenetic tools to control kinase activity in specific tissues or under specific conditions

  • Apply proximity labeling techniques (BioID, TurboID) to identify interaction partners in chloroplasts

  • Utilize cryo-electron microscopy for structural studies in near-native conditions

  • Employ metabolic labeling and click chemistry to track phytol metabolites in vivo

How might global climate change impact the function of phytol kinase 2 in crop plants?

Translational research questions connect basic science to agricultural applications:

  • Analyze expression and activity of phytol kinase 2 orthologs under elevated CO₂, temperature, and drought conditions

  • Compare wild species with domesticated crops for variations in phytol kinase 2 sequence and activity

  • Investigate potential roles in photosynthetic efficiency under stress conditions

  • Develop high-throughput phenotyping methods to screen for optimal phytol kinase 2 variants in diverse germplasm

  • Model the metabolic consequences of altered phytol phosphorylation under future climate scenarios

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.