Recombinant Arabidopsis thaliana Probable polyprenol reductase 1 (At1g72590)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cellular Biology

At1g72590 encodes Polyprenol Reductase 1 (PPRD1), a key enzyme in the dolichol biosynthesis pathway. Its primary functions include:

  • Polyprenol Reduction: Converts polyprenol (a lipid precursor) into dolichol, which anchors oligosaccharide precursors for N-glycosylation .

  • Regulation of Protein Glycosylation: Ensures proper folding and secretion of glycoproteins by maintaining dolichol availability .

  • Plant Growth and Development: Overexpression in Arabidopsis increases dolichol levels, altering root-to-shoot ratios and stress responses .

Enzymatic Activity and Complementation Studies

PPRD1 demonstrates functional redundancy with PPRD2 (encoded by At2g16530) in yeast (dfg10Δ) mutants:

StudyKey Findings
Yeast ComplementationPPRD1 and PPRD2 restore dolichol synthesis in dfg10Δ mutants; truncated variants (e.g., PPRD1-INT3) fail to complement .
In Vitro AssaysRecombinant PPRD1 reduces polyprenol to dolichol in a NADP+dependent manner .
Gene OverexpressionPPRD1-OE lines show 213% and 126% increased dolichol in leaves and roots, respectively .

Gene Expression Patterns

At1g72590 is responsive to environmental cues, as evidenced by GEO profiles:

  • Stress Responses: Upregulated under salt stress, ozone exposure, and IAA treatment .

  • Developmental Regulation: Expressed in pollinated pistils and during diurnal/circadian cycles .

Protein Production Platforms

While traditionally expressed in E. coli , Arabidopsis-based systems offer advantages for complex protein production:

PlatformAdvantages
E. coliHigh yield, cost-effective for soluble proteins .
Arabidopsis Super-Expression SystemEnables proper post-translational modifications (e.g., N-glycosylation) for membrane proteins .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during the order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized formulations, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
PPRD1; At1g72590; F28P22.22; Polyprenol reductase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PPRD1
Target Protein Sequence
MEVEIVWLVKAAWITVWIVSILPLVIASIPSSKLNSFRELVLSFAGRGKILHPSSQKFTV PQKFFGHFYVVGVVWTTLLLAATWMYACKMAGGSHVFSFHMTHVEHRFKVGRAVFLLLLM EIHVLRRVIESFYVFKYSTSARMHILAYVGALFYYVAAPLSLCSNIAPEVARFVGSQVAE FIASGKSHSHDFNLLLSISPLMKLGSLQWIGGAIFLWGWIHQRRCHAILGSLREYPSQAK EYIIPYGDWFEMVSCPHFLAEIVLYLGLLISSGGTDISIWLLFGFVAANLTYAAGETHRW YLQKFENYPASRHAIFPHVY
Uniprot No.

Target Background

Function
This protein plays a crucial role in the early stages of protein N-linked glycosylation. It is essential for converting polyprenol into dolichol. Dolichols are critical for synthesizing dolichol-linked monosaccharides and the oligosaccharide precursor used in N-glycosylation. This protein acts as a polyprenol reductase, facilitating the reduction of the alpha-isoprene unit of polyprenols into dolichols through an NADP-dependent mechanism. It is involved in regulating plant growth and reproductive processes.
Database Links

KEGG: ath:AT1G72590

STRING: 3702.AT1G72590.1

UniGene: At.35081

Protein Families
Steroid 5-alpha reductase family, Polyprenol reductase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots and flowers.

Q&A

What is Arabidopsis thaliana Probable polyprenol reductase 1 (At1g72590)?

Arabidopsis thaliana Probable polyprenol reductase 1 (PPRD1) is a protein encoded by the At1g72590 gene locus that catalyzes the conversion of polyprenol to dolichol in plant cells. This enzyme belongs to a family of three putative polyprenol reductases identified in the Arabidopsis proteome (At1G72590, At2G16530, and At3G43840) . PPRD1 is orthologous to human SRD5A3 (steroid 5α reductase type 3) and plays an important role in dolichol biosynthesis, which is essential for protein glycosylation in the endoplasmic reticulum . The predicted PPRD1 polypeptide comprises 320 amino acids and shares significant sequence similarity with human (47-54% similarity, 28-30% identity) and yeast (39-47% similarity, 26-27% identity) orthologs . Unlike its paralog PPRD2 (At3G43840), which is essential for plant viability, PPRD1 serves a complementary role in plant metabolism, with both enzymes demonstrating distinct expression patterns and physiological functions throughout plant development .

What is the biochemical mechanism of PPRD1 enzymatic activity?

PPRD1 catalyzes the reduction of the alpha-isoprene unit in polyprenols to form dolichols, which are essential glycosyl carrier lipids in eukaryotic cells. The enzyme functions by reducing the double bond in the alpha-isoprene unit of polyprenol, resulting in the formation of dolichol . This reaction represents a critical step in the dolichol biosynthetic pathway, which begins with the condensation of isopentenyl diphosphate (IPP) units to form polyprenol pyrophosphate, followed by dephosphorylation to polyprenol and subsequent reduction to dolichol . PPRD1's catalytic mechanism likely involves a conserved set of amino acid residues found in the steroid 5-alpha reductase enzyme family, to which it belongs . The enzymatic activity of PPRD1 requires specific cofactors, likely NADPH, similar to other enzymes in this family, though the exact kinetic parameters and structural determinants of substrate specificity remain areas of active investigation . Experimental evidence from overexpression studies demonstrates that increased PPRD1 activity directly correlates with elevated dolichol levels in plant tissues, confirming its functional role in dolichol biosynthesis .

How does PPRD1 relate to other polyprenol reductases in Arabidopsis?

In Arabidopsis thaliana, three putative polyprenol reductases have been identified: PPRD1 (At1G72590), PPRD2 (At3G43840), and a shorter protein encoded by At2G16530 that corresponds to the C-terminal region of PPRD1 and PPRD2 . Multiple sequence alignment analysis of these proteins reveals at least eight highly conserved regions, suggesting shared functional domains among plant PPRDs . Despite their structural similarities, PPRD1 and PPRD2 exhibit distinct expression patterns and physiological roles, with PPRD2 showing consistently higher expression levels across various tissues and developmental stages . While PPRD2 is essential for plant viability and its deficiency leads to severe developmental abnormalities, PPRD1 appears to play a complementary role that can partially compensate for PPRD2 deficiency . The third putative reductase (PPRD3) is significantly shorter (84 amino acids) compared to PPRD1 (320 amino acids) and PPRD2 (343 amino acids), corresponding only to the C-terminal portion of these enzymes, which raises questions about its functional capacity as a complete polyprenol reductase . The evolutionary relationship between these three polyprenol reductases suggests potential subfunctionalization or neofunctionalization events that have shaped their current roles in plant metabolism .

What cellular processes depend on PPRD1 activity?

PPRD1 activity is primarily linked to dolichol biosynthesis, which plays a crucial role in N-glycosylation of proteins in the endoplasmic reticulum (ER) . This post-translational modification is essential for protein folding, stability, and biological activity in all eukaryotic cells . Dolichols serve as glycosyl carrier lipids, forming dolichol-linked oligosaccharides that are subsequently transferred to nascent proteins in the ER lumen, representing the first step in the N-glycosylation pathway . Beyond protein glycosylation, dolichol and its derivatives participate in other cellular processes including dolichylation (a form of protein prenylation), cell wall biosynthesis, and potentially membrane fluidity regulation . PPRD1's role in these processes becomes particularly important under certain developmental conditions or stress situations, as evidenced by its differential expression patterns in various tissues and growth stages . The complementary relationship between PPRD1 and PPRD2 suggests a potential role in maintaining cellular homeostasis, where PPRD1 may provide backup capacity for dolichol production when PPRD2 activity is insufficient or under specific physiological demands .

What is the expression pattern of PPRD1 in Arabidopsis tissues?

PPRD1 exhibits a distinctive tissue-specific and developmentally regulated expression pattern in Arabidopsis thaliana. The gene is expressed in young seedlings, albeit at lower levels compared to its paralog PPRD2 . In mature plants, PPRD1 expression becomes more restricted, primarily detected in roots and flowers, whereas PPRD2 maintains expression across all plant organs including roots, leaves, stems, flowers, and pollen . As plants age, PPRD1 expression increases in the roots while decreasing in the leaves, suggesting a developmental regulation mechanism . Notably, PPRD1 transcript is absent in pollen, where only PPRD2 is expressed, indicating tissue-specific regulation and potentially distinct functions in male gametophyte development . The spatial and temporal expression patterns of PPRD1 suggest its specialized role in root and flower development, possibly related to specific glycosylation requirements in these tissues . Additionally, alternative splicing of PPRD1 has been observed, resulting in variants PPRD1-INT3 and PPRD1-INT4, which are detected particularly in leaf tissues, further complicating the expression landscape of this gene and suggesting potential isoform-specific functions .

What molecular mechanisms regulate PPRD1 transcription and activity?

The regulation of PPRD1 transcription and activity involves complex molecular mechanisms that respond to developmental cues and potentially environmental signals. Tissue-specific expression patterns suggest the presence of distinct regulatory elements in the PPRD1 promoter region that respond to tissue-specific transcription factors . The observation that PPRD1 expression increases in roots while decreasing in leaves as plants age indicates developmental stage-specific regulation mechanisms . Alternative splicing of PPRD1, resulting in PPRD1-INT3 and PPRD1-INT4 variants, represents another layer of post-transcriptional regulation that may generate protein isoforms with potentially modified activities or subcellular localizations . The dramatic upregulation of PPRD1 expression (up to 600-fold) observed in the GabiKat_575B02 line, where T-DNA insertion occurred in the promoter region, suggests the possible disruption of negative regulatory elements or the introduction of enhancer elements that influence transcription . At the post-translational level, PPRD1 activity might be regulated through protein-protein interactions, subcellular localization changes, or modifications affecting enzyme kinetics, though these mechanisms remain to be fully characterized . Understanding these regulatory mechanisms is crucial for explaining how plants coordinate the activities of PPRD1 and PPRD2 to maintain appropriate dolichol levels across different tissues and developmental stages .

What approaches can be used to express and purify recombinant PPRD1?

Recombinant expression and purification of Arabidopsis PPRD1 requires careful consideration of expression systems and purification strategies to obtain functionally active enzyme. For bacterial expression, the PPRD1 coding sequence can be cloned into pET-series vectors with affinity tags (His6, GST, or MBP) to facilitate purification . Expression in E. coli is typically induced with IPTG at lower temperatures (16-18°C) to enhance proper folding of the plant protein in the bacterial host . Alternatively, insect cell expression systems using baculovirus vectors may provide a eukaryotic environment more conducive to proper folding and potential post-translational modifications of PPRD1 . For plant-based expression, Agrobacterium-mediated transformation using binary vectors can be employed to express tagged versions of PPRD1 in Arabidopsis or tobacco . Purification strategies typically involve affinity chromatography as an initial step, followed by size exclusion chromatography to improve purity . Since PPRD1 is likely a membrane-associated enzyme, inclusion of appropriate detergents (such as CHAPS, DDM, or Triton X-100) during extraction and purification is crucial for maintaining protein solubility and activity . Enzyme activity should be assessed using radiometric or LC-MS-based assays measuring the conversion of radiolabeled or isotope-labeled polyprenol substrates to corresponding dolichols . Circular dichroism spectroscopy and thermal shift assays can be employed to verify proper folding and stability of the purified protein before proceeding to functional or structural studies .

What assays can be used to measure PPRD1 enzyme activity?

Several complementary approaches can be employed to assess PPRD1 enzyme activity, each with specific advantages for different research questions. Radiometric assays using [14C]-labeled polyprenol substrates provide sensitive quantification of enzyme activity by measuring the conversion to [14C]-dolichol products, which can be separated by thin-layer chromatography and quantified by scintillation counting . For higher resolution analysis, liquid chromatography-mass spectrometry (LC-MS) methods allow precise identification and quantification of polyprenol substrates and dolichol products based on their mass-to-charge ratios and retention times, enabling detailed kinetic studies of the enzyme . In vitro reconstitution assays can be performed using purified recombinant PPRD1, appropriate polyprenol substrates, and cofactors (likely NADPH), with reaction products analyzed by the methods mentioned above . For cellular assays, metabolic labeling of cells expressing recombinant PPRD1 with [3H]-mevalonate or [14C]-isopentenyl pyrophosphate allows tracking of the dolichol biosynthetic pathway in a more physiological context . Complementation assays in yeast polyprenol reductase mutants (dfg10Δ) provide a functional readout of PPRD1 activity based on restoration of normal growth and glycosylation patterns . Additionally, coupled enzyme assays monitoring NADPH oxidation spectrophotometrically (at 340 nm) can be developed for high-throughput screening of reaction conditions or potential inhibitors .

What molecular biology techniques are critical for studying PPRD1 gene function?

A comprehensive investigation of PPRD1 function requires an integrated approach combining various molecular biology techniques. For gene expression analysis, quantitative RT-PCR remains the gold standard for measuring PPRD1 transcript levels across tissues, developmental stages, or in response to experimental treatments . RNA-seq provides a broader transcriptomic context, revealing potential co-regulated genes and alternative splicing events, such as the PPRD1-INT3 and PPRD1-INT4 variants observed in Arabidopsis leaves . Promoter analysis using reporter gene fusions (PPRD1promoter::GUS or PPRD1promoter::GFP) in transgenic plants allows visualization of spatial and temporal expression patterns in planta . For protein localization, fluorescent protein tagging (PPRD1-GFP) combined with confocal microscopy enables determination of subcellular localization, with endoplasmic reticulum localization expected based on its function . Protein-protein interaction studies using yeast two-hybrid, bimolecular fluorescence complementation, or co-immunoprecipitation approaches can identify interaction partners that may regulate PPRD1 activity or connect it to other cellular pathways . Functional characterization through reverse genetics approaches, including T-DNA insertion lines, RNAi knockdown, or CRISPR/Cas9-mediated gene editing, provides insights into the physiological consequences of PPRD1 dysfunction . Biochemical analysis of lipid profiles, particularly polyprenol and dolichol content, in wild-type versus genetically modified plants offers direct evidence of PPRD1's metabolic function . Heterologous expression in other organisms, including yeast complementation studies, can validate the enzymatic function of PPRD1 and facilitate structure-function analyses through mutational approaches .

How do PPRD1 and PPRD2 functionally interact in dolichol biosynthesis?

PPRD1 and PPRD2 exhibit a complementary relationship in dolichol biosynthesis, with distinct but overlapping roles that ensure robust glycosylation capacity across different tissues and developmental stages. While both enzymes catalyze the conversion of polyprenol to dolichol, PPRD2 appears to be the primary polyprenol reductase in Arabidopsis, showing consistently higher expression levels across various tissues and developmental stages compared to PPRD1 . The essential nature of PPRD2 is demonstrated by the lethal phenotype of PPRD2-deficient plants, whereas PPRD1 deficiency produces less severe consequences . This functional hierarchy is further supported by the observation that PPRD1 can partially rescue dolichol deficiency in PPRD2-deficient cells, suggesting a backup role for PPRD1 when PPRD2 function is compromised . The tissue-specific expression patterns of these enzymes—with PPRD1 primarily expressed in roots and flowers of mature plants, and PPRD2 expressed across all organs including pollen—indicate tissue-specific division of labor . This differential expression may reflect varying demands for dolichol in different tissues or developmental contexts, with PPRD2 providing baseline dolichol synthesis capacity and PPRD1 contributing additional capacity in specific tissues or under particular conditions . The molecular mechanisms underlying this functional interaction remain to be fully elucidated but may involve shared regulatory networks, feedback mechanisms responding to cellular dolichol levels, or physical interactions between the two enzymes or with common partners in the dolichol biosynthetic pathway .

What insights from PPRD1 research apply to understanding human SRD5A3-related disorders?

Research on Arabidopsis PPRD1 provides valuable insights relevant to understanding human SRD5A3-related disorders, which include congenital disorders of glycosylation type Iq (CDG-Iq) and kahrizi syndrome. The functional orthology between plant PPRDs and human SRD5A3 is evidenced by their shared enzymatic activity in converting polyprenol to dolichol, a critical step in protein glycosylation pathways . This functional conservation offers the opportunity to use the more genetically tractable Arabidopsis system to investigate basic mechanisms of polyprenol reductase function and regulation that may be applicable to human SRD5A3 . Studies on PPRD1 and PPRD2 in Arabidopsis have revealed the tissue-specific expression patterns and developmental regulation of these enzymes, potentially informing our understanding of why certain tissues are more severely affected in human SRD5A3 deficiency disorders . The observation that PPRD1 can partially compensate for PPRD2 deficiency in Arabidopsis suggests that approaches to upregulate functionally related enzymes might be explored as therapeutic strategies for SRD5A3 disorders . Arabidopsis models with altered PPRD expression provide systems to test potential therapeutic compounds targeting polyprenol reductase activity or aimed at bypassing the metabolic block by alternative mechanisms . Furthermore, the relatively high sequence similarity between plant PPRDs and human SRD5A3 (47-54% similarity) suggests structural conservation that could inform structure-based drug design efforts directed at modulating human SRD5A3 activity . The accessible genetics of Arabidopsis allows rapid testing of mutations corresponding to human SRD5A3 variants to assess their functional consequences, potentially helping to classify variants of uncertain significance identified in patient populations .

How can CRISPR/Cas9 be used to study PPRD1 function and regulation?

CRISPR/Cas9 technology offers powerful approaches for investigating PPRD1 function and regulation with unprecedented precision. For complete gene knockout studies, CRISPR/Cas9 can be designed to target early exons of PPRD1, creating frameshift mutations that result in loss of function . Multiple guide RNAs targeting different regions of the gene can be employed simultaneously to increase editing efficiency or create larger deletions encompassing critical functional domains . For structure-function analysis, CRISPR/Cas9-mediated homology-directed repair allows precise introduction of point mutations in conserved residues predicted to be involved in catalysis or substrate binding, enabling correlation of specific amino acids with enzyme activity . Domain-specific deletions can be generated using pairs of guide RNAs targeting flanking sequences, allowing assessment of the functional importance of specific protein regions identified in multiple sequence alignments . For regulatory studies, CRISPR/Cas9 can be used to modify the PPRD1 promoter region, either deleting putative regulatory elements or introducing reporter genes to monitor expression patterns . The observation that T-DNA insertion in the PPRD1 promoter region led to significant upregulation of expression suggests potential negative regulatory elements that could be specifically targeted by CRISPR/Cas9 . CRISPR activation (CRISPRa) or interference (CRISPRi) systems can be employed for transient and tunable modulation of PPRD1 expression without permanent genetic modifications, allowing temporal control over gene expression levels . Multiplexed editing targeting both PPRD1 and PPRD2 simultaneously would allow creation of double mutants to overcome potential functional redundancy and reveal phenotypes masked by compensation between these paralogs . Base editing or prime editing variants of CRISPR can introduce precise nucleotide changes without double-strand breaks, useful for subtler modifications of regulatory elements or coding sequences with minimal off-target effects .

What potential biotechnological applications could emerge from PPRD1 research?

PPRD1 research opens several promising avenues for biotechnological applications related to glycoprotein production, plant stress tolerance, and biomedical research. Engineering plants with modified PPRD1 expression could enhance protein glycosylation efficiency, potentially improving the production of recombinant glycoproteins in plant-based biopharmaceutical platforms . The observation that PPRD1 overexpression leads to significantly increased dolichol levels suggests that metabolic engineering of the dolichol pathway could be achieved by modulating PPRD1 expression or activity . This approach might be particularly valuable for optimizing glycosylation of therapeutic proteins produced in plant systems, addressing one of the challenges in plant molecular farming . The tissue-specific expression pattern of PPRD1, particularly its presence in roots, suggests possible applications in engineering root development or stress responses to improve agricultural traits such as drought tolerance or nutrient uptake efficiency . Insights into the regulation of PPRD1 expression could inform strategies for controlling glycosylation capacity in response to specific environmental or developmental cues, potentially enhancing plant adaptation to stress conditions . The functional orthology between plant PPRDs and human SRD5A3 positions Arabidopsis as a valuable model system for screening compounds that modulate polyprenol reductase activity, with potential therapeutic applications for human congenital disorders of glycosylation . Development of biosensors based on PPRD1 activity or expression could provide tools for monitoring cellular glycosylation capacity or stress responses in plants . The knowledge gained from studying PPRD1's catalytic mechanism and substrate specificity could inform enzyme engineering efforts aimed at creating modified polyprenol reductases with altered properties for specific biotechnological applications .

How does PPRD1 function relate to plant stress responses and adaptation?

While direct evidence linking PPRD1 to stress responses is limited in the available literature, several lines of indirect evidence suggest potential roles in plant adaptation to environmental challenges. Protein glycosylation, which depends on dolichol produced by PPRD1 and PPRD2, plays critical roles in protein folding, stability, and function, particularly for secreted and membrane proteins that often function in stress sensing and response pathways . Changes in PPRD1 expression with plant age and across different tissues suggest developmental regulation that may be connected to shifting glycosylation demands under different physiological conditions or stress scenarios . The related cis-prenyltransferase AtHEPS, which produces betulaprenol (a polyprenol) in Arabidopsis, shows cold-stress-inducible expression, suggesting that polyisoprenoid metabolism more broadly may be responsive to abiotic stresses . This connection raises the possibility that PPRD1, which acts downstream in the pathway converting polyprenols to dolichols, might also be regulated under stress conditions . The increased expression of PPRD1 in roots compared to leaves as plants age could reflect adaptation to root-specific stresses or changing developmental requirements for glycosylated proteins in root tissues . Overexpression of PPRD1 leading to increased dolichol content might enhance cellular capacity for protein glycosylation under stress conditions when proper protein folding and stability become particularly critical . Research in other systems has shown that dolichol levels and protein glycosylation patterns can change in response to various stresses, suggesting that enzymes like PPRD1 may be part of broader stress adaptation mechanisms . A comprehensive analysis of PPRD1 expression, activity, and mutant phenotypes under different stress conditions would be valuable for elucidating its specific roles in plant stress responses and potential applications in improving crop resilience .

What are common challenges in purifying active recombinant PPRD1?

Purification of active recombinant PPRD1 presents several technical challenges that researchers should anticipate and address in their experimental design. As a membrane-associated enzyme involved in lipid metabolism, PPRD1 likely contains hydrophobic domains that can cause protein aggregation or misfolding when expressed in heterologous systems, particularly bacterial hosts . Selection of appropriate expression systems is critical, with insect cells or yeast potentially offering more suitable eukaryotic environments for proper folding and post-translational modifications compared to E. coli . Optimization of expression conditions, including lower temperatures (16-18°C), reduced inducer concentrations, and specialized E. coli strains (such as Rosetta or C41/C43 for membrane proteins), may improve soluble protein yield . Effective solubilization strategies using mild detergents (CHAPS, DDM, or Triton X-100) are essential for extracting PPRD1 from membranes while preserving its native conformation and activity . The choice of affinity tags can significantly impact purification success, with larger solubility-enhancing tags like MBP or SUMO potentially improving folding and solubility compared to smaller His6 tags . Maintaining enzyme stability during purification requires careful buffer optimization, including appropriate pH, ionic strength, glycerol content, and protease inhibitors . Assessing enzyme activity throughout the purification process is crucial but challenging due to the specialized substrates (polyprenols) and analytical methods (TLC, LC-MS) required for activity assays . Protein aggregation during concentration steps is a common issue that may be addressed by including stabilizing agents (glycerol, trehalose) or using alternative concentration methods like dialysis against high-molecular-weight PEG . Co-expression with potential cofactors or interacting proteins identified in Arabidopsis might improve folding and stability of recombinant PPRD1, though such factors remain to be identified .

What strategies can address functional redundancy between PPRD1 and PPRD2?

Several complementary strategies can help overcome the challenges posed by functional redundancy between PPRD1 and PPRD2 in Arabidopsis research. Generation of double mutants targeting both PPRD1 and PPRD2 simultaneously using CRISPR/Cas9 or traditional crossing of single mutants would reveal phenotypes masked by compensation between these paralogs, though complete double knockouts might be lethal based on the essential nature of PPRD2 . Conditional gene silencing approaches using inducible RNAi or CRISPR interference systems allow temporal control over gene suppression, enabling investigation of acute effects before compensatory mechanisms are established . Tissue-specific gene manipulation using promoters that drive expression in specific cell types can help focus on contexts where one gene may be more dominant, such as pollen where only PPRD2 is expressed, or roots where PPRD1 expression increases with age . Overexpression of one paralog in the background of the other's mutation can test the limits of functional compensation and reveal subfunctionalized roles . Designing chimeric proteins combining domains from PPRD1 and PPRD2 could help identify which protein regions are responsible for their distinct functions or expression patterns . Transcriptomic and proteomic profiling of single mutants can reveal compensatory changes in expression or activity of the remaining paralog and identify other genes that may participate in backup mechanisms . Biochemical approaches comparing substrate specificities, kinetic parameters, or interaction partners of purified PPRD1 and PPRD2 can reveal functional differences that might be exploited experimentally . Stress or developmental conditions that differentially affect PPRD1 versus PPRD2 expression might provide windows where one gene's function becomes more critical and its phenotypes more apparent . Comparative studies across different plant species with varying degrees of divergence between PPRD homologs could provide evolutionary context for understanding functional specialization between these genes in Arabidopsis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.