Recombinant Arabidopsis thaliana Probable protein cornichon homolog 2 (At1g12340)

What is Arabidopsis thaliana Probable Protein Cornichon Homolog 2?

Arabidopsis thaliana Probable Protein Cornichon Homolog 2 (At1g12340) is a small protein belonging to the cornichon family, comprising 129 amino acids with the sequence: MRGVTETDKLANGIFHLVCLADLEFDYINPYDSASRINSVVLPEFIVQGVLCVFYLLTGHWFMTLLCLPYLYYNFHLYSKRQHLVDVTEIFNLLNWEKKKRLFKLAYIVLNLFLTIFWMIYSALDDYED . The protein contains transmembrane domains characteristic of the cornichon family and is involved in protein trafficking from the endoplasmic reticulum (ER). Similar to other cornichon proteins, AtCNIH2 likely functions as a cargo receptor, facilitating the export of specific membrane proteins from the ER to their functional destinations .

How does AtCNIH2 compare structurally with other plant cornichon homologs?

Cornichon homologs across plant species share conserved structural elements, particularly the IFXXL sequence motif (similar to the IFRTL domain or IFX/NL in plants) that serves as an interaction site with COPII components like SEC24p . AtCNIH2 contains this conserved motif, which enables it to function in the early secretory pathway. When comparing AtCNIH2 with cornichon proteins from other species such as Physcomitrium patens (moss), there is significant homology in the core functional domains despite evolutionary distance between these plants . Like other cornichon proteins, AtCNIH2 contains multiple transmembrane domains that anchor it to the ER membrane, enabling it to facilitate cargo selection and export.

What are the optimal storage and reconstitution conditions for recombinant AtCNIH2?

For optimal handling of recombinant AtCNIH2, the protein should be stored at -20°C/-80°C upon receipt, with aliquoting recommended to minimize freeze-thaw cycles . The lyophilized protein powder is typically stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For reconstitution, it is recommended to briefly centrifuge the vial before opening to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Adding glycerol to a final concentration of 5-50% (with 50% being standard) is advised for long-term storage at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and function.

What expression systems are used for producing recombinant AtCNIH2?

Recombinant AtCNIH2 protein is commonly expressed in E. coli expression systems, as seen with the His-tagged version where the full-length protein (amino acids 1-129) is fused to an N-terminal His tag . This bacterial expression system allows for efficient production of the protein in quantities suitable for research applications. The resulting expressed protein typically achieves greater than 90% purity as determined by SDS-PAGE analysis . While E. coli is the predominant expression system, alternative systems such as yeast, insect cells, or plant-based expression systems could potentially be employed for specific research applications requiring post-translational modifications or when studying protein-protein interactions that might be affected by the expression host.

What methodologies are most effective for investigating AtCNIH2 cargo selection specificity?

Several complementary approaches can be employed to investigate AtCNIH2 cargo selection specificity:

• Split-ubiquitin yeast two-hybrid system: This technique is particularly useful for membrane protein interactions and has been successfully used to identify interactions between cornichon homologs and their cargo proteins .

• Bimolecular fluorescence complementation (BiFC): This in planta technique allows visualization of protein-protein interactions in their native cellular environment, as demonstrated with CNIH1/CNIH2-PINA interactions .

• Proteomic analysis: Techniques like iTRAQ-based proteomic analysis following UV-cleavable 4-hexylphenylazosulfonate (Azo)-solubilized microsomal protein extraction have been successfully used to identify potential cargoes of cornichon homologs, as demonstrated for AtCNIH5 .

• In-planta tripartite split-GFP assays: This technique provides another complementary approach for verifying protein interactions in the plant cellular context .

• CRISPR-Cas9 mutant analysis: Examining protein localization patterns in cornichon mutant backgrounds can reveal trafficking dependencies, as seen with PINA-EGFP localization studies in cnih mutants .

How does phosphate availability affect AtCNIH protein function and expression?

While the provided search results contain limited direct information about AtCNIH2 and phosphate response, studies on the related cornichon homolog AtCNIH5 provide valuable insights into potential regulatory mechanisms for the cornichon family. AtCNIH5 has been identified as a phosphate starvation-induced (PSi) gene preferentially expressed in the outer layers of the root above the apical meristem . Under phosphate limitation, AtCNIH5 functions as an ER cargo receptor regulating phosphate homeostasis by facilitating the ER export of phosphate transporters (PHT1s) .

For researchers investigating AtCNIH2, it would be valuable to determine whether its expression is similarly regulated by phosphate availability. Methodological approaches should include:

• qRT-PCR analysis of AtCNIH2 expression under varying phosphate conditions

• Promoter-reporter fusion studies to visualize tissue-specific expression changes

• Proteomic analysis comparing microsomal fractions from wild-type and cnih2 mutant plants under different phosphate regimes

• Phenotypic analysis of cnih2 mutants under phosphate limitation conditions

What is the impact of CNIH2 mutations on plant development and stress responses?

The functional consequences of CNIH2 mutations can be investigated through detailed phenotypic analyses. Based on studies of related cornichon proteins, researchers should focus on:

• Root architecture: Mutations in cornichon homologs can affect root hair length and density, as observed with cnih5 under phosphate deficiency . For AtCNIH2, examining primary root elongation, lateral root formation, and root hair development under various conditions would be informative.

• Auxin-related phenotypes: Given the interaction between cornichon proteins and auxin transporters like PINA , cnih2 mutants may display altered auxin distribution and consequently modified developmental patterns related to auxin responses.

• Nutrient homeostasis: Similar to AtCNIH5's role in phosphate homeostasis , AtCNIH2 may influence the trafficking of transporters for specific nutrients. Measuring nutrient levels in cnih2 mutant tissues could reveal such functions.

• Subcellular protein localization: In cornichon mutants, cargo proteins can be partially retained intracellularly . Examining the localization of potential cargo proteins in cnih2 backgrounds using fluorescent protein fusions would provide insights into AtCNIH2's trafficking functions.

What techniques are recommended for studying AtCNIH2 membrane topology and structure?

As a transmembrane protein, determining AtCNIH2's precise topology and structure requires specialized approaches:

• Hydropathy analysis and topology prediction: Computational prediction tools can provide initial models of transmembrane domains and protein orientation based on amino acid sequence.

• Protease protection assays: These can determine which domains are accessible from which side of the membrane, revealing orientation of loops and termini.

• Cysteine scanning mutagenesis: Systematic replacement of residues with cysteine followed by accessibility testing can map exposed regions.

• Epitope tagging combined with immunolocalization: Inserting epitope tags at various positions and determining their accessibility in intact vs. permeabilized cells can reveal membrane topology.

• Cryo-electron microscopy: For high-resolution structural studies, especially if protein complexes with interaction partners are of interest.

For AtCNIH2 specifically, focusing on the conserved IFXXL motif and its structural context would provide insights into cargo selection mechanisms and interaction with COPII components.

What are the best methods for detecting protein-protein interactions involving AtCNIH2?

Based on successful approaches with related cornichon proteins, the following methods are recommended for studying AtCNIH2 interactions:

When implementing these methods for AtCNIH2, researchers should consider using appropriate controls. For instance, the aquaporin AtPIP2 homo-oligomerization can serve as a positive control for BiFC assays, while non-interacting membrane proteins can serve as negative controls .

How can researchers effectively generate and characterize cnih2 mutants?

Based on approaches used for other cornichon genes, effective strategies for generating and characterizing cnih2 mutants include:

• CRISPR-Cas9 gene editing: This approach has been successfully used to create cornichon mutants, resulting in in-frame premature stop codons . For AtCNIH2, designing gRNAs targeting early coding regions would be most effective for creating null alleles.

• Homologous recombination: This method has been used to replace cornichon loci with selection markers like hygromycin resistance cassettes . This approach is particularly useful for creating complete gene deletions.

• T-DNA insertion lines: Checking existing Arabidopsis T-DNA insertion collections for insertions in AtCNIH2 may provide ready-made mutant lines.

For characterization, researchers should implement:

• Molecular verification: PCR-based genotyping, RNA expression analysis, and when possible, protein detection to confirm the mutation.

• Phenotypic analysis: Examining growth parameters, root architecture, response to hormones (particularly auxin), and nutrient uptake.

• Subcellular localization studies: Introducing fluorescently-tagged potential cargo proteins into cnih2 backgrounds to assess trafficking defects .

• Complementation tests: Reintroducing wild-type AtCNIH2 to confirm that observed phenotypes are specifically due to AtCNIH2 disruption.

What experimental design is recommended for studying AtCNIH2 function in different plant tissues and developmental stages?

A comprehensive experimental approach for studying tissue-specific and developmental regulation of AtCNIH2 function would include:

• Expression analysis:

  • Quantitative RT-PCR of AtCNIH2 across tissues and developmental stages

  • Promoter:GUS/GFP reporter constructs to visualize spatial and temporal expression patterns

  • RNA-seq analysis to identify co-expressed genes and potential regulatory networks

• Tissue-specific manipulation:

  • Tissue-specific promoter-driven expression of AtCNIH2 in cnih2 mutant backgrounds

  • Tissue-specific CRISPR-based gene silencing

  • Inducible expression/silencing systems to control timing of AtCNIH2 function

• Protein localization and trafficking studies:

  • Tissue-specific expression of fluorescently-tagged AtCNIH2

  • Co-localization with organelle markers and potential cargo proteins

  • FRAP (Fluorescence Recovery After Photobleaching) analysis to study protein dynamics

• Identification of tissue-specific interactors:

  • Tissue-specific immunoprecipitation coupled with mass spectrometry

  • Yeast two-hybrid or split-ubiquitin screens using tissue-specific cDNA libraries

  • Comparison of interactome profiles across tissues and developmental stages