Recombinant Arabidopsis thaliana Probable protein phosphatase 2C 11 (At1g43900)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
At1g43900; F28H19.16; F9C16.6; Probable protein phosphatase 2C 11; AtPP2C11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g43900
Target Protein Sequence
MKKTRNVASSPIECVHLQTKPTTTLVRSFFFFLFNSQTISSFIIFYLFLCSFFWFCQSPN LTNPSPPPLSVAPLRGDANSPPPESSSSPATKSSLMISSRDPNALFSGGGISFLAGVRTV KFSYGYSSLKGKRATMEDYFETRISDVNGQMVAFFGVFDGHGGARTAEYLKNNLFKNLVS HDDFISDTKKAIVEVFKQTDEEYLIEEAGQPKNAGSTAATAFLIGDKLIVANVGDSRVVA SRNGSAVPLSDDHKPDRSDERQRIEDAGGFIIWAGTWRVGGILAVSRAFGDKQLKPYVIA EPEIQEEDISTLEFIVVASDGLWNVLSNKDAVAIVRDISDAETAARKLVQEGYARGSCDN ITCIVVRFEVS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G43900

STRING: 3702.AT1G43900.1

UniGene: At.28764

Protein Families
PP2C family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the functional significance of Probable protein phosphatase 2C 11 in Arabidopsis thaliana?

Probable protein phosphatase 2C 11 (At1g43900) belongs to the serine/threonine phosphatase family in Arabidopsis thaliana. These phosphatases play crucial roles in cellular signaling networks by removing phosphate groups from phosphorylated serine and threonine residues on target proteins. In Arabidopsis, protein phosphatase 2C (PP2C) proteins are involved in multiple signaling pathways, including stress responses, hormone signaling, and developmental processes. PP2C 11 specifically has been implicated in regulatory mechanisms related to phosphorylation networks that modulate plant growth and adaptation to environmental stimuli. Similar to other plant phosphatases, PP2C 11 likely functions within a complex network of protein interactions that regulate phosphorylation states, thereby controlling protein activity and cellular responses to external and internal cues.

What are the known expression patterns of PP2C 11 in different Arabidopsis tissues?

PP2C 11 shows differential expression across various Arabidopsis tissues and developmental stages. Studying the expression pattern is essential for understanding its physiological roles. While comprehensive tissue-specific expression data for PP2C 11 is still being compiled, researchers typically analyze its expression using techniques similar to those applied for other phosphatases in Arabidopsis. Like the phosphatases described in search result documentation, expression analysis often involves:

  • Promoter-reporter fusion constructs (e.g., PP2C11pro:GUS) to visualize tissue-specific expression

  • Quantitative real-time PCR to measure transcript abundance across tissues

  • RNA sequencing data analysis from public databases

When investigating expression patterns, it's advisable to examine multiple growth stages and environmental conditions, as PP2C expression can be dynamically regulated in response to stimuli, similar to the regulation patterns observed for other phosphatases in Arabidopsis .

How does PP2C 11 subcellular localization inform its function?

The subcellular localization of PP2C 11 provides critical insights into its potential interaction partners and functional roles. Similar to other plant phosphatases, determining the precise localization involves:

  • Creating fluorescent protein fusions (such as PP2C 11-GFP)

  • Transient expression in plant systems (like Nicotiana benthamiana)

  • Co-localization studies with established subcellular markers

  • Confocal microscopy imaging

Research on other Arabidopsis phosphatases has demonstrated that subcellular targeting is essential for biological function. For example, the dual-targeting of AtPAP2 (a purple acid phosphatase) to both mitochondria and plastids via its C-terminal hydrophobic motif was shown to be critical for its biological actions in carbon metabolism regulation . Similarly, understanding PP2C 11 localization will provide crucial information about its functional context. Truncation experiments removing potential targeting sequences can help establish whether specific subcellular localization is essential for PP2C 11 function, as demonstrated for other phosphatases .

What expression systems are most effective for producing recombinant PP2C 11?

For recombinant expression of Arabidopsis PP2C 11, several expression systems can be considered, each with distinct advantages:

Expression SystemAdvantagesConsiderations
E. coli (BL21, Origami2)High yield, cost-effective, rapid growthMay require optimization for plant protein folding
Yeast (Pichia pastoris)Eukaryotic processing, higher folding fidelityLonger production time than bacteria
Insect cells (Baculovirus)Complex eukaryotic processingMore expensive, technically demanding
Plant-based (N. benthamiana)Native-like post-translational modificationsLower yield, longer production time

Based on experiences with similar phosphatases from Arabidopsis, bacterial expression systems like E. coli Origami2 (DE3) have been successfully used for expressing plant phosphatase domains . When expressing PP2C 11 in E. coli, consider these methodological approaches:

  • Optimize codon usage for E. coli expression

  • Test multiple expression tags (His, GST, MBP, SUMO) to improve solubility

  • Evaluate expression at reduced temperatures (16-20°C) to enhance proper folding

  • Include phosphatase inhibitors during purification to prevent autodephosphorylation

  • Test various induction conditions (IPTG concentration, induction time)

For detection of expressed protein, immunoblotting with tag-specific antibodies provides confirmation of successful expression, as demonstrated in Arabidopsis research methodologies for other phosphatases .

What purification strategies maintain PP2C 11 enzymatic activity?

Maintaining enzymatic activity during purification is critical for functional studies of PP2C 11. Based on approaches used for similar phosphatases:

  • Use affinity chromatography as the primary purification step (Ni-NTA for His-tagged constructs)

  • Include reducing agents (DTT or β-mercaptoethanol) in all buffers to maintain cysteine residues

  • Add glycerol (10-20%) to stabilize protein structure during storage

  • Consider ion exchange chromatography as a secondary purification step

  • Perform size exclusion chromatography to ensure homogeneity and remove aggregates

When optimizing the purification protocol, it's essential to assess phosphatase activity at each step to identify conditions that preserve enzymatic function. Test different buffer compositions, particularly varying pH (typically 7.0-8.0), salt concentrations (50-300 mM NaCl), and stabilizing additives. Document purification efficiency using SDS-PAGE with Coomassie staining and Western blot analysis, similar to the methods described for other recombinant Arabidopsis proteins .

How can I verify the structural integrity of purified recombinant PP2C 11?

Verifying structural integrity is crucial for ensuring that the recombinant PP2C 11 is properly folded and functional. Several complementary approaches can be employed:

  • Circular dichroism (CD) spectroscopy to assess secondary structure elements

  • Thermal shift assays to determine protein stability and proper folding

  • Limited proteolysis to probe the accessibility of cleavage sites

  • Size exclusion chromatography to detect aggregation or oligomerization states

  • Dynamic light scattering to evaluate size distribution and homogeneity

Additionally, enzymatic activity assays using generic phosphatase substrates (such as para-nitrophenyl phosphate) provide functional verification. For structural studies, homogeneity assessment is particularly important. Techniques like SDS-PAGE, native PAGE, and analytical ultracentrifugation can provide insights into the purity and structural state of the recombinant protein .

What substrates are recognized by PP2C 11 and how can substrate specificity be determined?

Determining the substrate specificity of PP2C 11 is fundamental to understanding its biological role. Several approaches can be employed to identify and characterize substrate interactions:

ApproachMethodologyInformation Gained
Generic substrate assayspara-nitrophenyl phosphate (pNPP) assayBasic phosphatase activity
Peptide arraysPhosphopeptide librariesSequence preferences around phosphorylation sites
Phosphoproteomic analysisComparison of wild-type and knockout/overexpression linesIn vivo substrates
Protein interaction studiesYeast two-hybrid, split-ubiquitin, co-immunoprecipitationPhysical interactions with potential substrates
In vitro dephosphorylationRecombinant substrates + PP2C 11Direct dephosphorylation capability

When analyzing phosphoproteomes to identify potential substrates, statistical approaches similar to those applied in the research of other Arabidopsis phosphatases should be used. For instance, quantified phosphopeptides can be categorized based on molecular function using gene ontology annotation, providing insights into the cellular processes potentially regulated by PP2C 11 .

For in vitro verification, recombinant candidate substrates can be phosphorylated using appropriate kinases and then incubated with purified PP2C 11 to assess dephosphorylation activity. This approach allows for the direct demonstration of enzymatic activity toward specific proteins.

How do environmental stresses affect PP2C 11 expression and activity?

Environmental stresses can significantly impact PP2C expression and activity in Arabidopsis. To characterize these effects for PP2C 11:

  • Analyze transcript levels under various stress conditions using qRT-PCR

  • Examine protein levels with immunoblotting using specific antibodies

  • Create reporter lines (e.g., PP2C11pro:GUS) to visualize tissue-specific stress responses

  • Assess enzymatic activity in plant extracts under stress conditions

Based on studies of other phosphatases in Arabidopsis, osmotic stress conditions (such as mannitol treatment) can influence both the expression and subcellular localization of signaling proteins . When designing experiments to investigate stress responses, include appropriate time course analyses, as both rapid responses (minutes to hours) and long-term adaptations (days) may occur.

For functional analysis, compare phenotypes of PP2C 11 knockout/knockdown lines and overexpression lines under stress conditions to wild-type plants. Measurements should include physiological parameters like root growth, stomatal conductance, ion content, and stress hormone levels to comprehensively characterize the role of PP2C 11 in stress responses.

What techniques are most appropriate for measuring PP2C 11 enzyme kinetics?

Measuring enzyme kinetics is essential for characterizing the catalytic properties of PP2C 11. Several methodologies can be applied:

  • Colorimetric assays: Using para-nitrophenyl phosphate (pNPP) as a substrate, which releases para-nitrophenol upon dephosphorylation, measurable at 405 nm

  • Malachite green assay: Detecting released inorganic phosphate from dephosphorylation reactions

  • Radiolabeled substrate assays: Using 32P-labeled substrates for high sensitivity measurements

  • Fluorescence-based assays: Employing fluorescent substrates that change emission properties upon dephosphorylation

When performing kinetic measurements, determine the following parameters:

ParameterDefinitionTypical Analysis Method
KmSubstrate concentration at half-maximal velocityMichaelis-Menten or Lineweaver-Burk plots
kcatCatalytic constant (turnover number)Vmax/[Enzyme]
kcat/KmCatalytic efficiencyCalculated from Km and kcat
IC50 valuesInhibitor concentration causing 50% inhibitionDose-response curves

For accurate kinetic measurements, ensure that: (1) initial velocity conditions are maintained (typically <10% substrate conversion), (2) enzyme concentration is in the linear response range, and (3) assay conditions (pH, temperature, buffer composition) are carefully controlled and reported .

How can I identify proteins that interact with PP2C 11 in planta?

Identifying protein interaction partners is crucial for understanding PP2C 11's role in signaling networks. Several complementary approaches can be employed:

  • Yeast two-hybrid (Y2H) screening: This approach has been successfully used for identifying protein interactions for other Arabidopsis phosphatases. When designing Y2H screens, consider using the intracellular portion (ICP) of PP2C 11 as bait to identify cytosolic interactors .

  • Mating-based split-ubiquitin assays: Particularly useful for membrane-associated proteins. This system has been successfully applied to test interactions of Arabidopsis histidine kinases with cytoskeleton-associated proteins and other signaling components .

  • Co-immunoprecipitation (Co-IP): Use epitope-tagged PP2C 11 expressed in Arabidopsis to pull down interacting proteins, followed by mass spectrometry identification.

  • Bimolecular Fluorescence Complementation (BiFC): For visualizing protein interactions in plant cells and determining their subcellular localization.

  • Förster Resonance Energy Transfer (FRET): For detecting protein-protein interactions in live cells with high spatial resolution.

When analyzing interaction data, consider constructing interaction networks similar to those developed for other Arabidopsis proteins, where proteins are organized based on their molecular function and biological processes, as demonstrated in phosphorylation network analyses .

How does PP2C 11 integrate into known stress signaling pathways in Arabidopsis?

Understanding how PP2C 11 integrates into established signaling pathways requires both genetic and biochemical approaches:

  • Epistasis analysis: Cross PP2C 11 mutants with mutants of known signaling components and analyze the phenotypes of single and double mutants to establish genetic hierarchies.

  • Hormone sensitivity assays: Test responses of PP2C 11 mutants to various plant hormones (abscisic acid, brassinosteroids, auxin) that mediate stress responses, similar to approaches used for other phosphatases in Arabidopsis .

  • Phosphoproteomics: Compare phosphorylation patterns between wild-type and PP2C 11 mutant plants under normal and stress conditions to identify affected signaling pathways.

  • Reporter gene expression: Monitor stress-responsive gene expression in PP2C 11 mutants using qRT-PCR or reporter constructs.

The integration of PP2C 11 into signaling networks can be visualized through network models that incorporate phosphorylation data, protein interactions, and genetic relationships. Such models can reveal both direct substrates and downstream effects of PP2C 11 activity, similar to the phosphorylation networks established for other Arabidopsis signaling components .

What approaches can resolve contradictory data about PP2C 11 interaction partners?

Contradictory results regarding protein interactions are common in research and require systematic approaches to resolve:

  • Validate interactions using multiple independent techniques (Y2H, BiFC, Co-IP, FRET) under identical experimental conditions.

  • Test interactions under different physiological conditions (normal growth, stress, different developmental stages) as interactions may be condition-dependent.

  • Create domain deletion/mutation constructs to identify specific interaction surfaces and critical residues.

  • Employ quantitative interaction assays to determine binding affinities, which may reveal why certain interactions are detected by some methods but not others.

  • Consider in vivo relevance by examining co-expression patterns and co-localization of putative interaction partners.

When confronted with contradictory data, systematic documentation of experimental conditions becomes crucial. For instance, research on Arabidopsis histidine kinases has demonstrated that interaction patterns can differ significantly depending on the experimental system used (e.g., yeast-based versus in planta methods) .

How can I design mutational studies to identify catalytic and regulatory sites in PP2C 11?

Rational design of mutations requires structural insights and sequence analysis. For PP2C 11, consider:

  • Sequence alignment with characterized PP2Cs to identify conserved catalytic residues

  • Homology modeling based on crystal structures of related phosphatases

  • Molecular dynamics simulations to identify potential substrate binding sites

  • Systematic alanine scanning of conserved residues

When designing mutations, focus on these key areas:

Domain/SiteMutation StrategyExpected Outcome
Catalytic siteReplace metal-coordinating residuesLoss of phosphatase activity
Substrate binding pocketAlter residues lining the pocketChanged substrate specificity
Regulatory domainsModify potential phosphorylation sitesAltered regulation
Protein interaction surfacesMutate surface-exposed residuesDisrupted protein interactions

For each mutant, characterize both in vitro properties (enzymatic activity, substrate specificity) and in vivo function through complementation of knockout lines. This approach has been successfully used for functional characterization of domains in other Arabidopsis signaling proteins, such as the extracellular domains of histidine kinases .

What are the best approaches for using CRISPR-Cas9 to generate PP2C 11 mutants?

CRISPR-Cas9 genome editing offers powerful approaches for generating targeted mutations in PP2C 11:

For functional characterization, compare the generated CRISPR mutants with traditional T-DNA insertion lines to verify phenotypic consistency. This approach has been widely adopted in Arabidopsis research and has proven valuable for understanding gene functions .

How can phosphoproteomics be used to identify PP2C 11 targets and signaling networks?

Phosphoproteomics offers powerful approaches for identifying potential PP2C 11 substrates and mapping its role in signaling networks:

  • Experimental design:

    • Compare phosphoproteomes of wild-type, PP2C 11 knockout, and overexpression lines

    • Analyze samples under normal conditions and relevant stress treatments

    • Include time-course sampling to capture dynamic phosphorylation changes

  • Sample preparation:

    • Enrich phosphopeptides using titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC)

    • Fractionate samples to increase phosphoproteome coverage

    • Consider targeted analysis of specific cellular compartments based on PP2C 11 localization

  • Data analysis:

    • Identify significantly changed phosphosites (typically p < 0.05 and fold change > 1.5)

    • Perform motif analysis on regulated phosphosites to identify sequence preferences

    • Conduct pathway enrichment analysis to identify regulated biological processes

  • Validation:

    • Confirm direct dephosphorylation of selected targets using in vitro assays

    • Generate phosphomimetic and phospho-null mutations in candidate substrates

    • Perform epistasis analysis between PP2C 11 and key substrates

Phosphoproteomic data can be integrated with other omics approaches (transcriptomics, metabolomics) to construct comprehensive signaling networks, similar to the phosphorylation networks developed for other Arabidopsis signaling components .

How can findings from PP2C 11 research be translated to crop improvement?

Translating findings from Arabidopsis PP2C 11 research to crop improvement involves several sequential steps:

  • Identify crop orthologs of PP2C 11 through phylogenetic analysis

  • Characterize expression patterns and function of these orthologs in crop species

  • Determine if the orthologous proteins have conserved or divergent functions

  • Develop breeding or gene editing strategies based on functional insights

As demonstrated in Arabidopsis translational research, many plant genes first characterized in Arabidopsis can be successfully studied in crop species, leveraging the extensive genetic and molecular tools available for this model plant . The high percentage of conserved gene functions between Arabidopsis and crops makes this translation feasible, though careful validation is necessary.

When translating PP2C 11 research to crops, consider these approaches:

  • Targeted modification of PP2C 11 orthologs in crops using CRISPR-Cas9

  • Overexpression or knockdown of specific PP2C genes to enhance stress tolerance

  • Identification of natural variants with altered PP2C activity for marker-assisted breeding

  • Development of phosphatase inhibitors as potential agrochemicals

For successful translation, it's essential to validate that the regulatory networks identified in Arabidopsis are conserved in the target crop species, as the degree of pathway conservation can vary significantly across plant lineages .

How does PP2C 11 function compare across different plant species?

Comparative analysis of PP2C 11 function across plant species provides evolutionary insights and identifies conserved mechanisms:

  • Conduct phylogenetic analysis to identify true orthologs versus paralogs

  • Compare protein sequence, domain structure, and key functional residues

  • Analyze expression patterns across equivalent tissues in different species

  • Test functional complementation by expressing orthologs in Arabidopsis PP2C 11 mutants

When studying conservation across species, it's important to note that while sequence conservation may be high, functional diversification can occur due to:

  • Differences in expression patterns or regulation

  • Altered protein interaction networks

  • Expanded or contracted gene families

  • Species-specific post-translational modifications

Research on Arabidopsis as a model system has shown that while many core cellular processes are highly conserved, species-specific adaptations have evolved to meet particular ecological challenges . Documenting these similarities and differences provides valuable insights into both fundamental biological mechanisms and species-specific adaptations.

What controls are essential for validating PP2C 11 knockout and overexpression lines?

  • Genetic verification:

    • PCR genotyping to confirm T-DNA insertion position or CRISPR-induced mutations

    • Sequencing to verify the exact mutation and rule out second-site mutations

    • Analysis of multiple independent transgenic lines to control for position effects

  • Expression verification:

    • RT-PCR or qRT-PCR to confirm transcript elimination (knockouts) or enhancement (overexpression)

    • Western blotting to verify protein absence or overexpression

    • Immunolocalization or fluorescent protein fusions to confirm altered protein expression patterns

  • Functional validation:

    • Complementation with wild-type PP2C 11 to confirm phenotypes are due to the targeted gene

    • Phosphatase activity assays in plant extracts to verify altered enzymatic activity

    • Phenotypic analysis under multiple environmental conditions to comprehensively characterize the mutant

  • Control lines:

    • Include wild-type segregants from the same genetic background

    • Use empty vector transformants as controls for overexpression studies

    • Include unrelated phosphatase mutants to distinguish general versus specific phosphatase effects

Documentation of these validation steps is essential for publication and reproducibility, following best practices established in Arabidopsis research methodology .

How should I design experiments to detect subtle phenotypes in PP2C 11 mutants?

Detecting subtle phenotypes requires careful experimental design:

  • Growth conditions:

    • Test multiple environmental conditions (light intensity, photoperiod, temperature, nutrient availability)

    • Apply specific stresses that may reveal conditional phenotypes

    • Analyze plants throughout their lifecycle to capture stage-specific effects

  • High-precision phenotyping:

    • Use automated imaging systems for quantitative growth analysis

    • Employ time-lapse photography to detect developmental timing differences

    • Analyze multiple morphological parameters (root architecture, leaf size, cell size, etc.)

  • Molecular phenotyping:

    • Transcriptome analysis to identify altered gene expression patterns

    • Metabolite profiling to detect biochemical changes

    • Hormone profiling to identify altered signaling pathways

  • Statistical considerations:

    • Increase biological replication (n ≥ 30 for each genotype)

    • Use power analysis to determine required sample size

    • Apply appropriate statistical tests (ANOVA with post-hoc tests, mixed-effects models)

    • Consider subtle differences with biological significance even if p-values are marginal

Research on other Arabidopsis signaling components has shown that phenotypes may be highly condition-dependent or revealed only under specific stresses or developmental stages , necessitating comprehensive phenotypic analysis under diverse conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.