Recombinant Arabidopsis thaliana Probable receptor-like protein kinase At5g15080 (At5g15080)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PBL34; PIX7; At5g15080; F2G14.200; Serine/threonine-protein kinase PBL34; PBS1-like protein 34; Receptor-like cytoplasmic kinase PBL34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-493
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PIX7
Target Protein Sequence
MGLDAVKAKGNWKSEKPKETENKNHKKKNGDDNKSRNEEEEEGEASGCWVKFRFMIGCIP SKSDLDASSSSIYGSNCTVTTMESKSANEKSNDQPVGQVSSTTTTSNAESSSSTPVISEE LNISSHLRKFTFNDLKLSTRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVK TLNPDGLQGHKEWLAEINFLGNLLHPNLVKLVGYCIEDDQRLLVYEFMPRGSLENHLFRR SLPLPWSIRMKIALGAAKGLSFLHEEALKPVIYRDFKTSNILLDADYNAKLSDFGLAKDA PDEGKTHVSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGE HNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDPKIRPKMSDVVE ALKPLPHLKDMASSSYYFQTMQAERLKNGSGRSQGFGSRNGQHQPVFRTLSSPHGSSPYR HQIPSPKPKGATT
Uniprot No.

Target Background

Function
This recombinant Arabidopsis thaliana probable receptor-like protein kinase At5g15080 (At5g15080) is involved in chitin-triggered immune signaling and is essential for reactive oxygen species (ROS) production. It functions downstream of SD129 in the defense signaling pathway activated by the pathogen-associated molecular pattern (PAMP) 3-OH-C10:0, a medium-chain 3-hydroxy fatty acid.
Database Links

KEGG: ath:AT5G15080

STRING: 3702.AT5G15080.1

UniGene: At.27315

Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family
Subcellular Location
Cell membrane; Lipid-anchor.

Q&A

What is the predicted structure and domain organization of At5g15080?

Receptor-like protein kinases (RLKs) in Arabidopsis typically feature an extracellular domain responsible for ligand perception, a transmembrane domain, and an intracellular kinase domain. Like other RLKs such as AtLYK5, At5g15080 would likely contain specific motifs in its extracellular domain that determine binding specificity. When studying At5g15080, researchers should consider analyzing its domain organization through bioinformatic tools and comparing it with well-characterized RLKs like AtLYK5, which contains LysM motifs in its extracellular domain for chitin binding. Structural prediction software can help identify potential binding sites and functional domains, informing experimental design and protein engineering strategies.

How is At5g15080 expression regulated in different tissues and under different conditions?

Expression patterns of receptor-like kinases often provide critical clues about their biological functions. To characterize At5g15080 expression, researchers should consider techniques such as qRT-PCR across different tissues and developmental stages. Drawing from studies of AtLYK5, it's important to examine expression under various stress conditions, particularly those that might trigger immune responses. The varying expression levels of LYK family members across tissues has been informative for understanding their redundant and distinct functions; for instance, AtLYK2 shows very low expression in all tissues examined . Similar expression analysis for At5g15080 could provide insights into its tissue-specific roles and potential functional overlap with other RLKs.

What are the optimal conditions for producing recombinant At5g15080 protein?

Producing functional recombinant receptor-like kinases presents several challenges due to their membrane association and complex domain organization. For At5g15080, researchers might consider the following approach:

  • Express the intracellular kinase domain separately in bacterial systems like E. coli, as demonstrated for AtLYK5 kinase domain expression

  • For full-length protein, consider eukaryotic expression systems like insect cells or plant-based transient expression

  • Include appropriate epitope tags (HA, GFP) for detection and purification

  • Optimize codon usage for the expression system selected

  • Implement solubility enhancement strategies such as fusion partners or chaperone co-expression

The purification protocol should be optimized based on cellular localization and biochemical properties. For membrane-associated kinases like At5g15080, detergent screening would be essential to maintain protein stability and functionality during extraction and purification.

How can researchers assess the kinase activity of At5g15080?

Determining whether At5g15080 possesses active kinase activity is fundamental to understanding its signaling mechanisms. An effective experimental approach would include:

  • Sequence analysis of the kinase domain to identify conserved catalytic residues (as performed for AtLYK5, which lacks critical residues in the P-loop, RD, and DFG domains)

  • In vitro kinase assays using purified protein to detect autophosphorylation or phosphorylation of artificial substrates

  • Mutational analysis of predicted catalytic residues (e.g., ATP-binding lysine)

  • Phosphoproteomic approaches to identify phosphorylation sites

Similar to AtLYK5, which lacks kinase activity but retains biological function through its kinase domain, it's important to consider that At5g15080 might function similarly - with its kinase domain mediating protein-protein interactions rather than catalytic activity . Comparisons with kinase-active RLKs like AtCERK1 could provide valuable controls for assay development.

What methods are most effective for identifying interaction partners of At5g15080?

Understanding the interactome of receptor-like kinases is crucial for elucidating their signaling networks. Recommended approaches include:

  • Co-immunoprecipitation (Co-IP) with epitope-tagged At5g15080 expressed in Arabidopsis protoplasts or transgenic plants, as implemented for AtLYK5-AtCERK1 interaction studies

  • Yeast two-hybrid screening using the intracellular domain as bait

  • Bimolecular fluorescence complementation (BiFC) for in vivo visualization of interactions

  • Mass spectrometry analysis of protein complexes isolated by affinity purification

  • Surface plasmon resonance (SPR) for quantitative binding kinetics with candidate partners

The critical factor in studying RLK interactions is considering ligand-dependent association. As shown with AtLYK5, its interaction with AtCERK1 is chitin-dependent . Therefore, researchers should test interactions both in the presence and absence of potential ligands. Additionally, protein localization studies using fluorescently-tagged At5g15080 would confirm membrane association, as verified for AtLYK5 using confocal microscopy with plasma membrane markers .

How can researchers identify the ligand for At5g15080?

Ligand identification represents one of the most challenging aspects of RLK characterization. Based on approaches used with other RLKs like AtLYK5, researchers might:

  • Perform pull-down assays with the recombinant extracellular domain as bait

  • Use affinity chromatography with immobilized candidate ligands

  • Conduct binding assays with potential ligands, measuring affinity through isothermal titration calorimetry (similar to the approach used to determine AtLYK5's affinity for chitooctaose)

  • Develop competition assays with labeled and unlabeled ligands

  • Implement functional screening by testing candidate molecule-induced responses in plants expressing At5g15080

The AtLYK5 study demonstrates the power of combining ligand-binding assays with computational modeling - researchers determined a binding affinity of 1.72 μM for chitooctaose, which was confirmed by point mutations in predicted binding residues . Similar structure-based approaches could guide ligand discovery for At5g15080.

What strategies should be employed to generate and characterize At5g15080 mutants?

Mutational analysis provides critical insights into structure-function relationships. Researchers investigating At5g15080 should consider:

  • CRISPR/Cas9-mediated gene editing to create knockout mutants

  • T-DNA insertion line screening from available Arabidopsis collections

  • Site-directed mutagenesis of key residues for complementation studies

  • Creation of chimeric proteins with domains from related RLKs to assess domain-specific functions

For functional characterization, the multilevel phenotyping approach used for AtLYK mutants provides an excellent template:

Functional AssayMeasurementRelevance
ROS ProductionLuminol-based detectionEarly immune response
MAPK ActivationImmunoblotting with phospho-specific antibodiesSignal transduction
Defense Gene ExpressionqRT-PCR of marker genesTranscriptional reprogramming
Pathogen ResistanceInfection assays with model pathogensBiological outcome

When analyzing mutant phenotypes, it's important to consider genetic redundancy, as demonstrated by the overlapping functions of AtLYK4 and AtLYK5 that necessitated the creation of double mutants to observe complete loss of chitin response .

How should researchers address potential functional redundancy in studies of At5g15080?

Functional redundancy represents a significant challenge when characterizing RLKs in Arabidopsis. To address this challenge:

  • Identify closest homologs to At5g15080 through phylogenetic analysis

  • Generate higher-order mutants (double, triple) with related genes

  • Perform complementation experiments with native and mutated versions of At5g15080

  • Analyze expression patterns for overlapping expression with homologs

  • Test for enhanced phenotypes under specific stress conditions

The AtLYK family demonstrates how initially subtle phenotypes in single mutants (like AtLYK5) can be dramatically enhanced in combination with related gene mutations (AtLYK4/AtLYK5) . A similar approach might reveal the full functional significance of At5g15080.

How can phosphoproteomics be leveraged to understand At5g15080 signaling networks?

Phosphorylation cascades represent a crucial aspect of RLK signaling. Advanced phosphoproteomic approaches to elucidate At5g15080 signaling might include:

  • Global phosphoproteomic analysis comparing wild-type and At5g15080 mutant plants under basal and stimulated conditions

  • Targeted phosphorylation site mapping on At5g15080 itself to identify regulatory modifications

  • Temporal phosphorylation dynamics following potential ligand application

  • Kinase-substrate relationship mapping using analog-sensitive kinase alleles

The importance of phosphorylation in RLK signaling is highlighted by the AtLYK5-AtCERK1 system, where chitin binding to AtLYK5 is indispensable for chitin-induced AtCERK1 phosphorylation . Similar investigation of At5g15080-dependent phosphorylation events would illuminate its position in signaling networks.

What considerations are important when designing At5g15080 overexpression systems for functional studies?

Overexpression systems provide valuable tools for RLK characterization, but require careful design:

  • Choice between native promoter (for physiological relevance) and constitutive promoter (for maximum expression)

  • Selection of appropriate tags that minimize interference with function

  • Consideration of tissue-specific expression using tissue-specific promoters

  • Inclusion of appropriate controls, including kinase-inactive versions

  • Verification of protein localization and expression levels

As demonstrated with AtLYK5, expression under native promoters in mutant backgrounds provides the most physiologically relevant complementation . Additionally, researchers should consider the potential of overexpression artifacts, particularly for proteins involved in multiprotein complexes where stoichiometry is important.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.