Recombinant Arabidopsis thaliana Probable receptor-like serine/threonine-protein kinase At4g34500 (At4g34500)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Arabidopsis thaliana Probable receptor-like serine/threonine-protein kinase At4g34500, also known as At4g34500, is a protein kinase superfamily protein found in the plant Arabidopsis thaliana . It is characterized as a probable receptor-like serine/threonine-protein kinase, suggesting its involvement in phosphorylation-based signaling pathways .

Here is some basic information about At4g34500:

DB identifierAT4G34500
Secondary Identifierlocus:2139559
Brief DescriptionProtein kinase superfamily protein
TAIR Short DescriptionProtein kinase superfamily protein
TAIR Computational DescriptionProtein kinase superfamily protein

Protein Structure and Function

At4g34500 belongs to the receptor-like kinase (RLK) family, which is one of the largest gene families in the Arabidopsis thaliana genome . RLKs play crucial roles in plant immunity and various signaling pathways. The protein contains a typical RD signaling domain in its catalytic loop and demonstrates autophosphorylation activity, which is essential for its function .

Kinase Activity and Inhibitors

Kinases, including At4g34500, are involved in various plant processes, such as stomatal closure, blue-light signaling, cortical microtubules, and ethylene production . Kinase activity can be modulated using inhibitors. For example, AMI-331 is a potent and selective CK1 inhibitor that can be used in Arabidopsis research . While At4g34500 is not directly targeted by AMI-331, this highlights the importance of understanding kinase function through inhibitor studies .

Involvement in Detoxification

Arabidopsis thaliana contains the aldo-keto reductase (AKR) family, which includes four enzymes (AKR4C8, AKR4C9, AKR4C10, and AKR4C11) that may detoxify sugar-derived reactive carbonyls (RCs) . Although At4g34500 is not part of the AKR family, understanding detoxification mechanisms in Arabidopsis provides a broader context for the plant's metabolic processes .

Protein-Protein Interactions

Arabidopsis thaliana has a large number of protein-coding genes and protein-protein interactions (PPIs) . Identifying PPIs can provide insights into the functional roles of proteins like At4g34500 .

Guanylyl Cyclase Activity

Some receptor-like kinases in Arabidopsis thaliana exhibit guanylyl cyclase (GC) activity, which is involved in signaling pathways . Although there is no direct evidence linking At4g34500 to guanylyl cyclase activity, exploring such activities in related kinases can provide insights into potential functions .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The specific tag will be determined during the production process. If you require a particular tag, please specify it in your order; we will prioritize fulfilling your request.
Synonyms
At4g34500; T4L20.80; Probable receptor-like serine/threonine-protein kinase At4g34500
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-437
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At4g34500
Target Protein Sequence
MSDSGGGSHKSSTTKPSVFGLNLYLVIAICSVFILLISLLIFLFVCLNRVSRARRMRVKH SSGSIPLVSKEISEIKTVGKFINSDDSKGKIGNEVVVVVSATSKEATSGFDTLSVASSGD VGTSEAMGWGKWYSLKDLEIATRGFSDDNMIGEGGYGVVYRADFSDGSVAAVKNLLNNKG QAEKEFKVEVEAIGKVRHKNLVGLMGYCADSAQSQRMLVYEYIDNGNLEQWLHGDVGPVS PLTWDIRMKIAIGTAKGLAYLHEGLEPKVVHRDVKSSNILLDKKWNAKVSDFGLAKLLGS ETSYVTTRVMGTFGYVSPEYASTGMLNECSDVYSFGVLLMEIITGRSPVDYSRPPGEMNL VDWFKGMVASRRGEEVIDPKIKTSPPPRALKRALLVCLRCIDLDSSKRPKMGQIIHMLEA EDFPFRPEHRSNQERSK
Uniprot No.

Target Background

Database Links

KEGG: ath:AT4G34500

STRING: 3702.AT4G34500.1

UniGene: At.28598

Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural classification of At4g34500 receptor-like kinase?

At4g34500 is classified as a member of the protein kinase superfamily in Arabidopsis thaliana. According to ThaleMine database, it is annotated as a "Protein kinase superfamily protein" . The protein contains characteristic domains of receptor-like kinases (RLKs), including a serine/threonine kinase domain. Structurally, it shares features with other RLKs that contain an extracellular domain, a transmembrane region, and an intracellular kinase domain. The kinase domain adopts an active conformation, even without phosphorylation, as observed in similar RLKs like FER (FERONIA) .

To determine the structural classification experimentally, researchers should:

  • Perform domain prediction analysis using tools like SMART or Pfam

  • Conduct phylogenetic analysis comparing At4g34500 sequence with known RLK families

  • Verify predictions with crystallographic studies of the protein structure

  • Examine conserved motifs, particularly in the kinase domain

What expression systems are available for producing recombinant At4g34500 protein?

Multiple expression systems have been developed for producing recombinant At4g34500 protein, each with specific advantages for different experimental applications. Based on commercial data from Cusabio, the following expression systems are currently available:

Expression SystemProduct CodeSpecial FeaturesApplications
YeastCSB-YP750715DOA1Post-translational modificationsStructural studies, functional assays
E. coliCSB-EP750715DOA1High yield, economicalBiochemical assays, antibody production
E. coli (Biotinylated)CSB-EP750715DOA1-BAvi-tag BiotinylatedProtein interaction studies, pull-down assays
BaculovirusCSB-BP750715DOA1Eukaryotic processingComplex structural studies, enzymatic assays
Mammalian cellCSB-MP750715DOA1Native-like modificationsIn vitro signaling studies

For optimal results, researchers should select the expression system based on their specific experimental needs. For kinase activity assays, the mammalian or baculovirus systems are recommended as they better preserve native post-translational modifications important for kinase function .

How is the kinase activity of At4g34500 experimentally measured?

The kinase activity of At4g34500 can be assessed through several complementary approaches:

  • In vitro kinase assays: Using purified recombinant protein with ATP and potential substrates (similar to methods used for FER kinase domain) . The reaction typically contains:

    • Purified kinase domain (10-100 ng)

    • ATP (50-100 μM)

    • Substrate protein (1-5 μg)

    • Kinase buffer (containing Mg²⁺ or Mn²⁺)

    • Incubation at 25-30°C for 30-60 minutes

  • Phosphorylation site mapping: Using mass spectrometry to identify auto-phosphorylation sites, which for related RLKs include conserved residues in the activation segment such as threonine and tyrosine residues .

  • Transphosphorylation assays: Co-expressing At4g34500 with potential substrate proteins in protoplasts and measuring phosphorylation events with phospho-specific antibodies, similar to methods used with FERONIA .

  • Period-lengthening activity assays: If At4g34500 shares functional properties with CK1 (Casein Kinase 1), researchers could monitor circadian period changes as an indirect measure of kinase activity .

What genetic resources are available for studying At4g34500 function in Arabidopsis?

Several genetic resources have been developed for studying At4g34500 function in Arabidopsis:

  • T-DNA insertion lines: Available through stock centers like ABRC and NASC, providing knockout or knockdown mutants of At4g34500.

  • Ecotype variations: As observed with other retroposons in Arabidopsis, researchers should be aware of potential polymorphisms across different ecotypes that might affect At4g34500 expression or function. PCR screening across 16 ecotypes for similar retroposons revealed significant variations in some cases, with differences in the 3' end regions .

  • Expression vectors: Constructs for complementation studies include variations with different promoters (native pAt4g34500 or constitutive promoters like pACTIN2) and epitope tags (GFP, myc) .

  • Site-directed mutant collections: Based on studies of similar RLKs, key residues for mutation studies include:

    • The ATP-binding lysine (equivalent to K565 in FER)

    • Dimerization interface residues (equivalent to R712, P740, E751 in FER)

    • Activation segment phosphorylation sites

What is the mechanism of activation for At4g34500 and related receptor-like kinases?

Recent studies on related RLKs like FERONIA provide insight into potential activation mechanisms for At4g34500. Unlike many kinases that require phosphorylation for activation, FER-KD (kinase domain) adopts an active conformation even without phosphorylation . This unique activation mechanism involves:

  • Active conformation without phosphorylation: Crystallographic evidence shows that the FER kinase domain adopts a "BLAminus" conformation with "DFGin" orientation (residues 679-681) even without phosphorylation .

  • Dimerization-dependent allosteric activation: Recent findings reveal that FER uses face-to-face dimerization as a mechanism to facilitate substrate-specific activation . Key residues in this dimerization interface include:

    • R712 (located in αG helix)

    • P740 (located in αG-αH loop)

    • E751 (located in αH helix)

  • Regulatory spine formation: In active RLKs, a regulatory spine consisting of conserved residues including HRD-His, DFG-Phe, C-helix Glu+4, and a residue in the loop preceding strand β4 is properly formed .

To study this mechanism in At4g34500, researchers should:

  • Determine if At4g34500 can adopt an active conformation without phosphorylation

  • Identify potential dimerization interfaces through structural prediction and mutagenesis

  • Test whether mutations in putative dimerization interface residues affect kinase activity

How to investigate the substrate specificity of At4g34500?

Investigating the substrate specificity of At4g34500 requires a multi-faceted approach:

  • In vitro kinase assays with candidate substrates: Based on known substrates of related RLKs, test potential substrates such as:

    • GRP7 (glycine-rich RNA-binding protein 7), a known substrate of FER

    • Transcription factors involved in signaling pathways

    • Components of the plant immune response

  • Phosphoproteomic screening: Perform large-scale phosphoproteomic analysis comparing wild-type and At4g34500 mutant plants to identify differentially phosphorylated proteins. This approach requires:

    • Treatment with appropriate stimuli (e.g., RALF peptides for FER-like kinases)

    • Protein extraction and phosphopeptide enrichment

    • LC-MS/MS analysis

    • Bioinformatic identification of phosphorylation motifs

  • Yeast two-hybrid screening: Identify potential interacting partners that might serve as substrates, using the kinase domain as bait.

  • In vivo validation: Confirm candidate substrates through co-immunoprecipitation and in vivo phosphorylation assays, similar to the protoplast-based system used to validate GRP7 phosphorylation by FER .

What structural features distinguish At4g34500 from other plant receptor-like kinases?

Structural analysis of At4g34500 compared to other plant RLKs reveals several distinguishing features:

  • Activation segment flexibility: If At4g34500 resembles FER-KD, it may contain a highly flexible activation segment. In FER-KD/ADP crystal structure, the activation segment (residues 678-708) contains an unmodeled 16-residue middle portion, suggesting high flexibility .

  • DFG motif orientation: The conserved DFG motif (critical for ATP binding) orientation determines whether kinases adopt active or inactive conformations. In active FER-KD, the DFG motif adopts a "DFGin" conformation .

  • Ion pair formation: Active kinases typically form an ion pair between a conserved lysine (K565 in FER) and glutamate (E581 in FER). This feature can be used to assess the activation state of At4g34500 .

  • Dimerization interface: Recent studies identified crucial residues in the dimerization interface of FER, including R712, P740, and E751. Mutations in these residues significantly reduce kinase activity . Comparative analysis can determine if At4g34500 contains similar dimerization interfaces.

To experimentally determine these structural features, researchers should:

  • Perform crystallographic studies of At4g34500 kinase domain

  • Use molecular dynamics simulations to predict flexible regions

  • Create site-directed mutations in key residues and assess their impact on kinase activity

How does phosphorylation regulate At4g34500 activity and what are the key phosphorylation sites?

While At4g34500's precise phosphorylation pattern hasn't been fully characterized, insights from related RLKs suggest a complex regulatory mechanism:

  • Dual-specificity kinase activity: Studies on FERONIA revealed it functions as a dual-specificity kinase, capable of phosphorylating both serine/threonine and tyrosine residues . This suggests At4g34500 may also possess dual-specificity, potentially phosphorylating:

    • Serine/threonine residues (classical RLSK activity)

    • Tyrosine residues (less common in plants but present in some RLKs)

  • Critical phosphorylation sites: Based on FER studies, key phosphorylation sites likely reside in the activation segment. In FER, these include:

    • T696 (threonine)

    • S701 (serine)

    • Y704 (tyrosine)

  • Intermolecular mechanism: Autophosphorylation likely occurs through an intermolecular mechanism (trans-phosphorylation) rather than intramolecular (cis-phosphorylation), requiring dimerization or oligomerization of kinase domains .

  • Functional importance: Autophosphorylation appears necessary for efficient substrate phosphorylation, as demonstrated for FER where initiating substrate phosphorylation requires autophosphorylation of specific activation segment residues .

To identify and characterize phosphorylation sites in At4g34500, researchers should:

  • Perform in vitro autophosphorylation assays with recombinant protein

  • Use mass spectrometry to map phosphorylation sites

  • Create phospho-mimetic (S/T→D/E) and phospho-null (S/T→A) mutations to assess functional significance

  • Test kinase activity against substrates with wild-type and mutant variants

What methodologies are most effective for studying At4g34500 dimerization and its role in signaling?

Based on recent discoveries about dimerization-dependent activation in similar RLKs, several methodologies can effectively probe At4g34500 dimerization:

  • Co-immunoprecipitation with differently tagged variants: Express At4g34500 with different epitope tags (e.g., GFP and myc) and perform co-immunoprecipitation to detect interactions. This approach has successfully demonstrated dimerization in FER variants .

  • Förster Resonance Energy Transfer (FRET): Create fusion proteins with fluorescent protein pairs (e.g., CFP/YFP) to measure protein-protein interactions in vivo, which can detect dimerization events in real-time within plant cells.

  • Site-directed mutagenesis of putative dimerization interface: Based on FER studies, mutations in key residues of the dimerization interface (particularly the αG-αH loop region) can significantly reduce dimerization and kinase activity . Researchers should:

    • Identify equivalent residues in At4g34500 (homologous to R712, P740, E751 in FER)

    • Create point mutations (typically to alanine)

    • Assess impact on dimerization and kinase activity

  • Titration experiments: Following FER methodology, introduce increasing amounts of a kinase-inactive variant (e.g., K→R mutation in ATP-binding site) alongside wild-type protein to assess enhancement of kinase activity .

  • Structural analysis: Crystallography or cryo-EM studies of the kinase domain can directly visualize dimerization interfaces.

For functional validation in vivo, researchers should assess:

  • Phosphorylation of known substrates in the presence of dimerization mutants

  • Phenotypic complementation of knockout mutants with dimerization-deficient variants

  • Response to relevant stimuli (if known) in plants expressing dimerization-deficient variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.