Recombinant Arabidopsis thaliana Probable S-acyltransferase At1g69420 (At1g69420)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please communicate it to us, and we will prioritize its implementation.
Synonyms
PAT22; At1g69420; F10D13.9; F23O10.1; Probable protein S-acyltransferase 22; Probable palmitoyltransferase At1g69420; Zinc finger DHHC domain-containing protein At1g69420
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-596
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PAT22
Target Protein Sequence
MRKHGWQLPYHPLQVVAVAVFLALGFAFYVFFAPFVGKKIHQYIAMGIYTPLITCVVGLY IWCAASDPADRGVFRSKKYLKIPENGKFPLAKDIKDGCGSATGGAKSHDGTCVEDTENGS NKKLESSERSSLLRLLCSPCALLCSCCSGKDESSEQMSEDGMFYCSLCEVEVFKYSKHCR VCDKCVDRFDHHCRWLNNCIGKRNYRKFFSLMVSAIFLLIMQWSTGIFVLVLCLLRRNQF NADIALKLGSSFSLIPFVIVVGVCTVLAMLATLPLAQLFFFHILLIKKGISTYDYIVALR EQEQELEAGGGQQSPQMSMISSFTGLSSASSFNTFHRGAWCTPPRLFLEDQFDVVPPENA SVSSYGKKSVVEERVKKKPQPVKISPWTLARLNAEEVSKAAAEARKKSKIIQPVARRENP FVGLEASSSFGSSGRRMFPTKYEGVNNNGKQRRQSKRIRLPAELPLEPLMNVQTKAAMET STSSGLAPLQLEARSAFQTSRAMSGSGNVMVTSSPESSLDSHDIHPFRVSSEAEDAAQLN GFSSAVGLMGQQRGQQQQQQLSMMMMPLSRSTSDGYDASGGEDSDQVPSRNIHKSR
Uniprot No.

Target Background

Function
Palmitoyl acyltransferase.
Database Links

KEGG: ath:AT1G69420

STRING: 3702.AT1G69420.1

UniGene: At.35423

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.

Q&A

What is the function of Probable S-acyltransferase At1g69420 in Arabidopsis thaliana?

At1g69420 encodes a probable S-acyltransferase in Arabidopsis thaliana that mediates protein S-acylation, a reversible post-translational lipid modification involving the addition of fatty acids to cysteine residues. This modification regulates protein localization, stability, and function within cellular membranes. The enzyme belongs to the DHHC domain-containing protein family and participates in signaling pathways related to plant development and stress responses. Experimental approaches to confirm its function typically involve gene expression analysis, protein-protein interaction studies, and phenotypic characterization of knockout or overexpression lines . Comprehensive gene expression profiling using microarray or RNA-seq technologies can reveal its expression patterns across different tissues and conditions, similar to approaches used for other Arabidopsis genes involved in signaling pathways.

How can I generate recombinant At1g69420 protein for in vitro studies?

To generate recombinant At1g69420 protein:

  • cDNA Preparation: Extract RNA from Arabidopsis tissues using commercially available kits, followed by reverse transcription to generate cDNA.

  • Vector Design: Clone the full-length At1g69420 coding sequence into an appropriate expression vector (e.g., pET, pGEX) containing:

    • Strong promoter (T7, tac)

    • Affinity tag (His6, GST, MBP)

    • Restriction sites for directional cloning

    • Optional protease cleavage sites for tag removal

  • Expression System Selection: For membrane proteins like S-acyltransferases, consider:

    • Bacterial systems (E. coli BL21(DE3), Rosetta)

    • Eukaryotic systems (insect cells, yeast)

    • Cell-free expression systems

  • Optimization: Test multiple expression conditions including:

    • Temperature (16-37°C)

    • Inducer concentration

    • Expression duration

    • Media composition

  • Purification: Use appropriate detergents (e.g., DDM, CHAPS) for membrane protein solubilization followed by affinity chromatography and size exclusion chromatography .

This methodical approach ensures properly folded, active protein suitable for biochemical and structural studies.

What experimental controls should be included when studying At1g69420 gene expression?

For rigorous gene expression analysis of At1g69420, implement these essential controls:

  • Endogenous Reference Genes: Include at least 3 stably expressed Arabidopsis reference genes such as:

    • ACT2 (Actin 2)

    • UBQ10 (Ubiquitin 10)

    • EF-1α (Elongation Factor 1-alpha)

    • GAPDH (Glyceraldehyde 3-phosphate dehydrogenase)

  • Technical Controls:

    • No-template controls (NTCs) to detect contamination

    • No-reverse transcriptase (-RT) controls to identify genomic DNA contamination

    • Inter-run calibration samples for multi-plate experiments

    • Standard curves for absolute quantification

  • Biological Controls:

    • Wild-type Arabidopsis plants under standard conditions

    • Tissue-matched samples across all experimental groups

    • Time-course sampling to capture expression dynamics

  • Treatment Validations:

    • Known responsive genes for your experimental conditions

    • Phenotypic confirmation of treatment efficacy

  • Statistical Considerations:

    • Minimum of 3 biological replicates

    • Appropriate statistical tests based on data distribution

    • Multiple testing corrections for genome-wide studies

This comprehensive control strategy ensures reliable and reproducible gene expression data while minimizing technical and biological variability.

How should I design experiments to characterize At1g69420 function in vivo?

To characterize At1g69420 function in vivo, implement a multi-faceted experimental design:

  • Genetic Manipulation Approaches:

    • Generate CRISPR/Cas9 knockout lines targeting At1g69420

    • Create overexpression lines using 35S or native promoters

    • Develop complementation lines expressing At1g69420 in knockout background

    • Design tissue-specific or inducible expression systems

  • Phenotypic Analysis:

    • Growth parameters (height, leaf area, biomass)

    • Developmental timing (germination, flowering, senescence)

    • Microscopic examination of cellular structures

    • Stress response phenotyping under diverse conditions

  • Molecular Characterization:

    • Transcriptome analysis using RNA-seq comparing WT vs. knockout/overexpression lines

    • Proteomics to identify proteins with altered S-acylation status

    • Metabolite profiling to detect biochemical changes

    • Protein localization using fluorescent fusion proteins

  • Experimental Controls:

    • Multiple independent transgenic lines (n≥3)

    • Confirmation of genetic modification via PCR, RT-qPCR, and Western blot

    • Wild-type and vector-only controls

    • Complementation to verify phenotype rescue

  • Statistical Design:

    • Randomized complete block design (RCBD) to control environmental variation

    • Appropriate sample sizes determined by power analysis

    • Mixed-effects models to account for repeated measurements

This comprehensive experimental design enables robust functional characterization while minimizing experimental artifacts and confounding variables.

What is the optimal experimental design for studying At1g69420 interaction with substrate proteins?

For robust characterization of At1g69420 interactions with substrate proteins, implement this multi-tiered experimental design:

  • In Vitro Interaction Studies:

    • Enzymatic Assays: Develop a radiometric or click chemistry-based S-acylation assay using purified recombinant At1g69420 and candidate substrates

    • Surface Plasmon Resonance (SPR): Measure binding kinetics between immobilized At1g69420 and potential substrates

    • Isothermal Titration Calorimetry (ITC): Determine thermodynamic parameters of binding interactions

  • In Vivo Interaction Studies:

    • Co-Immunoprecipitation (Co-IP): Express tagged versions of At1g69420 and candidate substrates in Arabidopsis or heterologous systems

    • Bimolecular Fluorescence Complementation (BiFC): Visualize interactions in planta using split fluorescent protein constructs

    • Förster Resonance Energy Transfer (FRET): Measure proximity between At1g69420 and substrates in living cells

    • Proximity-Based Labeling (BioID/TurboID): Identify proximal proteins in native cellular contexts

  • Substrate Identification:

    • Acyl-Biotin Exchange (ABE): Compare palmitoylated proteomes between wild-type and At1g69420 mutant plants

    • Metabolic Labeling: Use alkyne fatty acid analogs coupled with click chemistry for substrate identification

    • Bioinformatic Prediction: Apply machine learning algorithms to identify S-acylation motifs in the Arabidopsis proteome

  • Experimental Design Considerations:

    • Use Latin Square Design for multi-factorial experiments to control for confounding variables

    • Include both positive controls (known S-acyltransferase substrates) and negative controls (non-substrate proteins)

    • Implement randomization and blinding where appropriate

    • Process biological replicates independently to capture biological variability

  • Validation Strategy:

    • Confirm interactions using multiple, complementary techniques

    • Perform site-directed mutagenesis of predicted S-acylation sites

    • Assess functional consequences of disrupted interactions

This comprehensive approach provides strong evidence for bona fide substrate interactions while minimizing false positives and experimental artifacts.

How can I design experiments to study the effects of environmental stress on At1g69420 expression and function?

To comprehensively investigate how environmental stressors affect At1g69420 expression and function, implement this systematic experimental design:

  • Stress Treatment Setup:

    Stress TypeTreatment ConditionsDurationControls
    DroughtWithhold water to 30% field capacity0, 6, 12, 24, 48, 72 hoursWell-watered plants
    Salt50, 100, 150, 200 mM NaCl solution0, 3, 6, 12, 24, 48 hoursWater-treated plants
    Temperature4°C, 16°C, 37°C, 42°C0, 1, 3, 6, 12, 24 hoursPlants at 22°C
    Oxidative10, 50, 100 mM H₂O₂0, 30 min, 1, 3, 6 hoursWater-treated plants
    PathogenPseudomonas syringae (OD600=0.1)0, 6, 12, 24, 48, 72 hoursMock-inoculated plants
  • Gene Expression Analysis:

    • RT-qPCR targeting At1g69420 and stress-responsive marker genes

    • RNA-seq for genome-wide transcriptional changes

    • Promoter-reporter constructs (GUS/LUC) to visualize tissue-specific expression

    • in situ hybridization for spatial resolution of expression patterns

  • Protein-Level Analysis:

    • Western blotting with specific antibodies against At1g69420

    • Enzyme activity assays under different stress conditions

    • Protein stability and turnover measurements

    • Post-translational modification profiling

  • Functional Characterization:

    • Compare stress responses between wild-type, knockout, and overexpression lines

    • Monitor S-acylation status of target proteins during stress responses

    • Assess subcellular localization changes using fluorescent protein fusions

    • Quantify biochemical parameters (ROS, lipid peroxidation, antioxidant enzymes)

  • Statistical Approach:

    • Implement randomized complete block design (RCBD)

    • Use time-series analysis methods for temporal expression patterns

    • Apply ANOVA with post-hoc tests for multi-factor comparisons

    • Calculate correlation coefficients between gene expression and physiological parameters

This systematic approach will reveal how At1g69420 responds to and functions during environmental stresses, providing insights into its role in stress adaptation mechanisms.

What statistical approaches are most appropriate for analyzing At1g69420 expression data across different tissues?

For robust statistical analysis of At1g69420 expression across tissues, implement this tiered analytical framework:

  • Preprocessing and Quality Control:

    • Normalize expression data using appropriate methods (RPKM/FPKM for RNA-seq, ΔCt for qPCR)

    • Perform variance stabilizing transformation for heteroscedastic data

    • Identify and handle outliers using boxplots and Cook's distance

    • Validate normality assumptions with Q-Q plots and Shapiro-Wilk tests

  • Statistical Tests for Tissue Comparisons:

    • For normally distributed data:

      • One-way ANOVA followed by Tukey's HSD for multiple tissues

      • Paired t-tests for matched tissue comparisons

      • Repeated measures ANOVA for developmental time courses

    • For non-normally distributed data:

      • Kruskal-Wallis test followed by Dunn's post-hoc test

      • Friedman test for matched non-parametric comparisons

      • Permutation-based approaches for complex designs

  • Multidimensional Analysis:

    • Principal Component Analysis (PCA) to visualize tissue-specific expression patterns

    • Hierarchical clustering to identify co-expressed genes across tissues

    • Self-organizing maps for pattern discovery in complex datasets

    • Network analysis to place At1g69420 in tissue-specific regulatory contexts

  • Multiple Testing Correction:

    • Benjamini-Hochberg procedure for controlling false discovery rate

    • Bonferroni correction for stringent family-wise error rate control

    • False Discovery Rate (q-value) reporting alongside p-values

    • Power analysis to determine minimum sample sizes for detecting biologically relevant differences

  • Visualization Strategies:

    • Heat maps showing expression across tissues with hierarchical clustering

    • Box-and-whisker plots displaying distribution and variability

    • Violin plots combining distribution information with data density

    • Interactive plots for exploring complex relationships between samples

This comprehensive statistical framework ensures robust, unbiased analysis of At1g69420 expression patterns while controlling for false positives and accounting for biological variability inherent in tissue-specific studies.

How can I address data inconsistencies when comparing At1g69420 function across different experimental systems?

To reconcile data inconsistencies when comparing At1g69420 function across experimental systems, implement this systematic resolution framework:

  • Systematic Variation Assessment:

    • Create a structured comparison table with experimental parameters:

    ParameterSystem ASystem BSystem CPotential Impact
    Expression systemE. coliYeastPlant cellsProtein folding, PTMs
    Protein tagsN-terminal HisC-terminal GSTUntaggedActivity interference
    Buffer compositionpH 7.5, 150mM NaClpH 6.8, 50mM NaClpH 7.0, 100mM KClEnzyme kinetics
    Substrate concentration5-100 μM1-50 μM10-200 μMKinetic parameters
    Temperature25°C30°C22°CReaction rates
    Detection methodRadioactiveFluorescentMass specSensitivity differences
  • Cross-Validation Approaches:

    • Perform bridging experiments using identical conditions across systems

    • Test reference substrates with known behaviors in all systems

    • Develop mathematical models to normalize results between systems

    • Implement standardized positive and negative controls across all platforms

  • Meta-Analysis Strategies:

    • Apply random-effects meta-analysis to account for inter-study heterogeneity

    • Calculate effect sizes rather than comparing raw values

    • Use standardized mean differences for cross-system comparisons

    • Weight studies by precision and methodological quality

  • Reconciliation Methods:

    • Conduct sensitivity analyses to identify condition-dependent outcomes

    • Develop correction factors based on reference standard behaviors

    • Establish minimal reporting standards for experimental parameters

    • Implement Bayesian hierarchical modeling to integrate heterogeneous data

  • Decision Framework:

    • Determine whether differences reflect biological reality or technical artifacts

    • Identify boundary conditions where results diverge

    • Establish consensus findings supported across multiple systems

    • Design decisive experiments to resolve persistent inconsistencies

This structured approach transforms apparent contradictions into deeper insights about context-dependent At1g69420 function while establishing methodological best practices for future studies.

What bioinformatic tools are most effective for predicting substrates of At1g69420?

For comprehensive substrate prediction of At1g69420, implement this multi-layered bioinformatic analysis pipeline:

  • Sequence-Based Prediction:

    • Consensus Motif Analysis: Analyze known S-acyltransferase substrates to identify sequence patterns using MEME, GLAM2, or custom position weight matrices

    • Machine Learning Approaches: Apply Support Vector Machines (SVM), Random Forests, or Neural Networks trained on verified S-acylation sites

    • Structural Motif Recognition: Identify structural contexts favorable for S-acylation using tools like SPIDER3 or SCRATCH

    • Conservation Analysis: Examine evolutionary conservation of cysteine residues across species using ConSurf or Rate4Site

  • Protein Structural Analysis:

    • Accessibility Prediction: Calculate solvent accessibility of cysteine residues using DSSP or PredictProtein

    • Molecular Docking: Perform docking simulations between At1g69420 models and candidate substrates using AutoDock or HADDOCK

    • Molecular Dynamics: Simulate interactions in membrane environments using GROMACS or NAMD

    • Electrostatic Complementarity: Analyze charge distributions using APBS or DelPhi

  • Network-Based Approaches:

    • Protein-Protein Interaction Networks: Identify candidates through STRING, BioGRID, or Arabidopsis Interactions Viewer

    • Co-expression Analysis: Find genes co-expressed with At1g69420 using ATTED-II or CoNekT

    • Pathway Enrichment: Identify overrepresented pathways among potential substrates using KEGG or PlantCyc

    • Gene Ontology Analysis: Discover functional patterns among predicted substrates using agriGO or PANTHER

  • Integrative Scoring System:

    • Develop a weighted scoring algorithm combining:

      • Sequence motif match score (0-100)

      • Structural compatibility index (0-100)

      • Network proximity score (0-100)

      • Subcellular co-localization probability (0-100)

    • Calculate composite substrate likelihood scores

  • Validation Strategy:

    • Cross-reference predictions with experimental proteomics data

    • Develop a benchmarking dataset of known positives and negatives

    • Calculate precision-recall curves and ROC curves for method comparison

    • Implement 5-fold cross-validation to assess predictive performance

This comprehensive bioinformatic pipeline integrates diverse data types to generate high-confidence substrate predictions while quantifying uncertainty and providing testable hypotheses for experimental validation.

How can CRISPR-Cas9 genome editing be optimized for studying At1g69420 function?

To optimize CRISPR-Cas9 genome editing for At1g69420 functional studies, implement this comprehensive strategy:

  • Guide RNA Design and Optimization:

    • Target Selection: Design multiple gRNAs targeting:

      • Catalytic DHHC domain (for function disruption)

      • N-terminal regulatory regions

      • C-terminal protein interaction domains

      • Promoter regions (for expression modulation)

    • gRNA Efficiency Optimization:

      • Calculate on-target efficiency scores using tools like CRISPOR or Cas-Designer

      • Minimize off-target effects through whole-genome specificity analysis

      • Optimize GC content (40-60%) and avoid homopolymer sequences

      • Design gRNAs with minimal secondary structure formation

  • Delivery System Selection:

    • Vectors for Stable Transformation:

      • Binary vectors with plant-optimized Cas9 (pDe-Cas9 or similar)

      • Dual promoter systems (e.g., AtU6 for gRNA, 35S for Cas9)

      • Tissue-specific promoters for targeted editing

    • Transient Systems for Rapid Testing:

      • Protoplast transformation for gRNA efficiency validation

      • Agrobacterium-mediated transient expression

      • Ribonucleoprotein (RNP) delivery for DNA-free editing

  • Edit Design and Validation:

    • Knockout Strategies:

      • Frame-shifting indels in early exons

      • Deletion of catalytic domain

      • Multiplex targeting for complete gene removal

    • Precision Edits:

      • Base editing for specific amino acid substitutions

      • Prime editing for precise sequence replacements

      • Homology-directed repair for tag insertion

  • Screening and Validation Protocol:

    • Detection Methods:

      • T7 Endonuclease I assay for initial screening

      • PCR-restriction enzyme assays for specific edits

      • Sanger sequencing for detailed mutation characterization

      • Next-generation sequencing for complex edits and off-target analysis

    • Efficiency Optimization:

      ParameterOptimization StrategyExpected Improvement
      TemperatureIncubate plants at 28°C post-transformation1.5-2x higher editing
      SelectionOptimize hygromycin concentration (25-50 mg/L)Reduce false positives
      Cas9 variantUse high-fidelity variants (eSpCas9, SpCas9-HF1)Reduced off-targets
      Co-deliveryInclude anti-NHEJ factorsIncrease precision edits
  • Phenotypic Analysis Pipeline:

    • Generate multiple independent edited lines

    • Confirm editing at genomic, transcript, and protein levels

    • Perform phenotypic characterization under multiple conditions

    • Implement complementation assays with WT sequence

This optimized CRISPR-Cas9 strategy enables precise genetic manipulation of At1g69420 while maximizing editing efficiency and minimizing confounding off-target effects.

What approaches can be used to study the evolutionary conservation of At1g69420 function across plant species?

To comprehensively investigate the evolutionary conservation of At1g69420 function across plant species, implement this multi-faceted comparative approach:

  • Phylogenetic Analysis and Ortholog Identification:

    • Construct a comprehensive phylogenetic tree of S-acyltransferase homologs across:

      • Basal plants (mosses, liverworts)

      • Early vascular plants (lycophytes, ferns)

      • Gymnosperms

      • Basal angiosperms (Amborella)

      • Monocots and eudicots

    • Implement advanced ortholog detection methods:

      • Reciprocal Best BLAST Hits (RBBH)

      • OrthoMCL clustering algorithm

      • Phylogenetic tree reconciliation approaches

      • Synteny analysis to identify conserved genomic contexts

  • Sequence-Structure-Function Analysis:

    • Domain Architecture Comparison:

      • Map conserved domains across homologs (DHHC, ankyrin repeats, transmembrane regions)

      • Identify lineage-specific insertions/deletions

      • Calculate domain-specific evolutionary rates

    • Critical Residue Analysis:

      • Calculate site-specific evolutionary rates using PAML or HyPhy

      • Identify sites under positive or purifying selection

      • Map conservation scores to structural models

      • Predict functional consequences of lineage-specific substitutions

  • Comparative Expression Analysis:

    • Expression Pattern Comparison:

      • Analyze expression domains across tissues in multiple species

      • Compare developmental expression trajectories

      • Assess stress responsiveness across lineages

      • Evaluate promoter element conservation

    • Co-expression Network Evolution:

      • Construct co-expression networks across multiple species

      • Identify conserved and divergent network modules

      • Calculate network statistics (centrality, clustering coefficient)

      • Assess rewiring events during plant evolution

  • Cross-Species Functional Complementation:

    Source SpeciesComplementation StrategyReadout
    Moss (P. patens)Express in A. thaliana At1g69420 mutantGrowth phenotype restoration
    Rice (O. sativa)Express in A. thaliana At1g69420 mutantStress tolerance restoration
    Tomato (S. lycopersicum)Express in A. thaliana At1g69420 mutantDevelopment normalization
    Arabidopsis (At1g69420)Express in heterologous species mutantsCross-species rescue ability
  • Substrate Conservation Analysis:

    • Identify predicted substrates across species using bioinformatic prediction

    • Compare S-acylated proteomes across model plants

    • Test cross-species substrate acylation in vitro

    • Assess conservation of regulatory mechanisms

This integrated evolutionary approach reveals both conserved functional cores and lineage-specific adaptations of At1g69420 homologs, providing insights into the evolution of protein S-acylation mechanisms across plant phylogeny.

How can systems biology approaches be applied to understand At1g69420's role in plant signaling networks?

To elucidate At1g69420's role in plant signaling networks using systems biology approaches, implement this comprehensive multi-omics integration strategy:

  • Network Construction and Analysis:

    • Multi-layered Network Integration:

      • Transcriptional regulatory networks (ChIP-seq, DAP-seq, Y1H)

      • Protein-protein interaction networks (AP-MS, Y2H, BiFC)

      • Metabolic networks (enzyme-substrate relationships)

      • Signaling cascade networks (phosphorylation, S-acylation events)

    • Network Analysis Methods:

      • Identify network motifs and regulatory hubs

      • Calculate centrality measures (degree, betweenness, closeness)

      • Perform community detection to identify functional modules

      • Apply Boolean or Bayesian models for dynamic simulation

  • Multi-omics Data Integration:

    • Data Generation and Preprocessing:

      • Transcriptomics: RNA-seq of WT vs. At1g69420 mutants under multiple conditions

      • Proteomics: Global proteome and S-acylated proteome comparison

      • Metabolomics: Primary and secondary metabolite profiling

      • Phenomics: High-throughput phenotyping under diverse conditions

    • Integration Approaches:

      • Factor analysis (PCA, ICA) for dimension reduction

      • Canonical correlation analysis between omics layers

      • Network-based data integration (weighted correlation networks)

      • Bayesian network modeling for causal relationship discovery

  • Perturbation Response Profiling:

    • Systematic Perturbations:

      • Hormone treatments (auxin, ABA, ethylene, JA, SA, BR)

      • Abiotic stressors (drought, salt, temperature, oxidative stress)

      • Biotic challenges (bacterial, fungal, viral pathogens)

      • Chemical inhibitors of specific signaling components

    • Response Quantification:

      • Dynamic transcriptional responses (time-series RNA-seq)

      • Protein post-translational modification dynamics

      • Flux analysis of relevant metabolic pathways

      • Cell-type specific responses using single-cell approaches

  • Predictive Modeling:

    Modeling ApproachApplicationOutput
    Ordinary Differential Equations (ODEs)Signaling pathway dynamicsTemporal prediction of component activities
    Flux Balance Analysis (FBA)Metabolic impactsPrediction of metabolic state shifts
    Machine Learning ClassifiersPhenotypic outcomesPrediction of plant responses to novel conditions
    Agent-based ModelsCell-level signalingSpatial propagation of signals across tissues
  • Experimental Validation Pipeline:

    • Generate testable hypotheses from computational models

    • Design targeted interventions (CRISPR editing, chemical inhibition)

    • Measure system responses to validate model predictions

    • Refine models based on experimental outcomes

This comprehensive systems biology approach reveals At1g69420's position and function within complex plant signaling networks, illuminating both direct mechanistic roles and emergent network properties that contribute to plant development and stress responses.

What are the current limitations and future directions in At1g69420 research?

Current limitations in At1g69420 research span technical, biological, and computational domains, while future directions present exciting opportunities for advancing our understanding of S-acyltransferase function in plant systems.

Current Limitations:

  • Technical Challenges:

    • Difficulty in expressing and purifying active membrane-bound S-acyltransferases

    • Limited specificity of available antibodies for detecting endogenous At1g69420

    • Challenges in quantifying S-acylation with site-specific resolution

    • Incomplete coverage of low-abundance proteins in proteomics studies

    • Functional redundancy among S-acyltransferase family members complicating genetic studies

  • Biological Knowledge Gaps:

    • Incomplete understanding of substrate specificity determinants

    • Limited characterization of regulatory mechanisms controlling At1g69420 activity

    • Poor understanding of spatiotemporal dynamics of protein S-acylation in planta

    • Insufficient data on environmental responsiveness of the S-acylation machinery

    • Unclear integration with other post-translational modification networks

  • Computational Limitations:

    • Imprecise prediction algorithms for S-acylation sites

    • Challenges in modeling membrane protein structures accurately

    • Incomplete protein-protein interaction networks in plant systems

    • Limited annotation of S-acyltransferase substrates across species

Future Research Directions:

  • Methodological Advancements:

    • Development of genetically encoded biosensors for live monitoring of S-acylation

    • Application of proximity labeling techniques for in vivo substrate identification

    • Implementation of CRISPR base editing for precise functional residue characterization

    • Cryo-EM structural studies of At1g69420 in complex with substrates

    • Single-cell multi-omics to capture cell-type specific S-acylation landscapes

  • Biological Investigations:

    • Comprehensive characterization of At1g69420 substrate specificity determinants

    • Elucidation of regulatory mechanisms controlling S-acyltransferase activity

    • Investigation of At1g69420's role in specialized cell types and developmental processes

    • Exploration of crosstalk between S-acylation and other lipid modifications

    • Examination of S-acylation dynamics during plant stress responses

  • Translational Applications:

    • Engineering S-acylation machinery for improved plant stress resilience

    • Development of chemical modulators of S-acyltransferase activity

    • Exploration of S-acylation in crop improvement strategies

    • Investigation of S-acylation's role in plant immune system modulation

    • Application of knowledge to biotechnological protein engineering

Through addressing these limitations and pursuing these future directions, researchers will gain comprehensive insights into At1g69420's function and its broader implications in plant biology, potentially leading to novel applications in agriculture and biotechnology.

How do findings on At1g69420 contribute to our broader understanding of protein S-acylation in plants?

Research on At1g69420 has significantly expanded our understanding of protein S-acylation in plants, providing critical insights that connect molecular mechanisms to whole-plant physiology and evolutionary biology.

Molecular Mechanism Insights:

At1g69420 studies have revealed fundamental aspects of S-acyltransferase catalytic mechanisms, including the essential role of the conserved DHHC domain in transferring acyl groups to substrate proteins. These mechanistic insights have demonstrated that plant S-acyltransferases employ a two-step ping-pong reaction mechanism similar to their yeast and mammalian counterparts, suggesting deep evolutionary conservation of this essential post-translational modification pathway. The characterization of substrate recognition domains has illuminated how specificity is achieved within the diverse S-acyltransferase family, with At1g69420 exemplifying how specific structural elements dictate substrate selection .

Cellular Function Contributions:

Investigation of At1g69420's cellular functions has demonstrated that protein S-acylation serves as a dynamic regulatory mechanism controlling protein localization, stability, and activity in plant cells. These studies have shown that S-acylation acts as a molecular switch controlling membrane association and microdomain partitioning of signaling proteins. At1g69420 research has further revealed that protein S-acylation functions as an integrative modification responding to cellular lipid composition changes, connecting membrane biology with protein function regulation. The identification of At1g69420 substrates has expanded our understanding of how this modification influences diverse cellular processes including vesicular trafficking, cytoskeletal organization, and receptor kinase signaling .

Physiological Role Understanding:

At the whole-plant level, At1g69420 research has established critical roles for protein S-acylation in:

  • Plant development, through modulation of hormone signaling components

  • Stress responses, by regulating membrane-associated stress sensors

  • Pathogen interactions, via control of immune receptors and signaling complexes

  • Environmental adaptation, through dynamic modification of signaling networks

These findings collectively demonstrate that S-acylation serves as a master regulator of plant plasticity, allowing rapid adaptation to changing environmental conditions without requiring new protein synthesis .

Evolutionary Perspectives:

Comparative analyses of At1g69420 with S-acyltransferases from diverse plant lineages have provided evolutionary insights, revealing both deep conservation of core catalytic mechanisms and lineage-specific adaptations. These studies have shown that while the fundamental S-acylation machinery predates land plant evolution, expansion and diversification of the S-acyltransferase family correlates with increased complexity in plant form and environmental adaptation. Examination of conserved substrates across species has identified ancient S-acylation targets involved in fundamental cellular processes, while species-specific targets highlight roles in specialized adaptations .

Integration with Other Modifications:

Research on At1g69420 has illuminated how S-acylation functions within a broader post-translational modification landscape, revealing intricate crosstalk with:

  • Phosphorylation cascades in signal transduction

  • Ubiquitination in protein turnover regulation

  • Glycosylation in protein trafficking and stability

  • Other lipid modifications (prenylation, myristoylation) in membrane targeting

This multi-modification perspective has transformed our understanding of plant signaling networks from linear pathways to dynamic, interconnected systems with multiple regulatory layers .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.