Recombinant Arabidopsis thaliana Probable S-acyltransferase At2g33640 (At2g33640)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize development of the specified tag.
Synonyms
PAT21; At2g33640; F4P9.41; Protein S-acyltransferase 21; Probable palmitoyltransferase At2g33640; Zinc finger DHHC domain-containing protein At2g33640
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-565
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PAT21
Target Protein Sequence
MARRHGWQLPAHTFQVVAITVFFLLTVAYYAFFAPFLGNKLYEYIAIGVYSFLAFSVLVL YIRCTGIDPADPGIFVKADNTPAHKSQNSNYVPENASAIDGGPYIRHGSGCCSAIGRFIC GCLVIQDCRRDTQQEQSNEQEEALFCSLCNAEVRMFSKHCRSCGKCVDGFDHHCRWLNNC VGQKNYISFVCLMAASFFWLIAEFGVGVTVFVRCFVDQKAMEHLITEKLGLGFSRPPFAA VVVVCTTLSLLALIPLGELFFFHMILIRKGITTYEYVVALRAQTEPLGTSVDELDQTSQY PSPASSAVTATSARSSLGLSIQYRGASLCTPPNIFVDQQDDVIQHLEPGPVRSTIDPDSL SQKKPPQRQQVRINPWKLAKLDSKEASKAAAKARASSSVLLPVSSRQNPYKTSSNVSGRS SPGRGKPADSESCSLSSPGLTRDHFNPMYMSSPANESPLNEEESRNAVVAARRNLPSSDE SSVVWDPEAGRFVSLSRIPGTDVGGPLGNECLNTITSTGTDRSRRARGNPLTGYFQQVRS QRGDQLPVFMPTDSQLHRHLSTRFH
Uniprot No.

Target Background

Function
S-acyltransferase involved in protein lipid modification.
Database Links

KEGG: ath:AT2G33640

STRING: 3702.AT2G33640.1

UniGene: At.37901

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is S-acyltransferase At2G33640 and what is its primary function in Arabidopsis thaliana?

At2G33640 (PAT21) is a member of the Protein S-Acyl Transferase (PAT) family in Arabidopsis thaliana, responsible for catalyzing S-acylation, a reversible post-translational lipid modification in which long-chain fatty acids covalently attach to specific cysteine residues of target proteins via thioester bonds . This modification enhances protein hydrophobicity, contributes to membrane association, and plays critical roles in protein trafficking, stability, and signaling . Functionally, PAT21 has been demonstrated to play essential roles in Arabidopsis sexual reproduction, with loss-of-function mutations resulting in complete failure of seed production . The protein contains a characteristic catalytic Asp-His-His-Cys cysteine-rich domain (DHHC-CRD) that is essential for its enzymatic activity .

How does PAT21 relate to other members of the PAT family in Arabidopsis?

PAT21 is one of 24 PAT family members identified in Arabidopsis thaliana . All members of this family share the characteristic DHHC-CRD domain responsible for their catalytic activity. While only five PATs had been thoroughly characterized at the time of the cited research, the evidence indicates that different PAT family members play diverse roles in plant growth, development, senescence, and stress responses . PAT21 is distinguished by its specific and critical role in reproductive processes, as its dysfunction causes complete sterility - a phenotype that may not be compensated for by other PAT family members, suggesting functional specialization within this enzyme family .

What are the specific reproductive defects caused by PAT21 mutation?

Loss-of-function mutation by T-DNA insertion in PAT21 (designated as atpat21-1) results in complete failure of seed production . Detailed phenotypic analysis revealed that this sterility is caused by defects in both male and female sporogenesis and gametogenesis . At the cellular level, researchers observed massive chromosome fragmentation and the absence of synapsis during the initial stages of meiosis in pollen mother cells . This indicates that PAT21 plays a critical role in early meiotic processes, particularly in chromosome integrity and synapsis formation.

Reproductive ProcessObserved Defect in atpat21-1 Mutants
SporogenesisDefective in both male and female lines
GametogenesisDefective in both male and female lines
MeiosisMassive chromosome fragmentation
SynapsisComplete absence during early meiosis
Seed ProductionComplete failure

What experimental approaches are recommended for investigating PAT21 substrate specificity?

To investigate PAT21 substrate specificity, researchers should employ a multi-faceted approach:

  • Biotin-switch assay: This technique allows detection of S-acylated proteins by replacing thioester-linked acyl groups with biotin, enabling purification and identification of S-acylated proteins in wild-type versus pat21 mutant plants .

  • Acyl-RAC (Resin-Assisted Capture): This method offers improved sensitivity for detecting S-acylated proteins by capturing them on thiopropyl sepharose resin after hydroxylamine treatment.

  • Mass spectrometry analysis: After identifying potential substrates using either method above, tandem mass spectrometry can identify the specific cysteine residues that undergo S-acylation.

  • In vitro S-acylation assays: Using purified recombinant PAT21 protein and potential substrate proteins, researchers can determine direct enzymatic activity and site specificity .

  • Yeast two-hybrid or split-ubiquitin assays: These methods can help identify direct protein-protein interactions between PAT21 and potential substrates.

What are the optimal conditions for expressing recombinant At2G33640/PAT21?

The recombinant full-length Arabidopsis thaliana At2G33640 (PAT21) protein has been successfully expressed in E. coli with an N-terminal His tag . For optimal expression:

  • Expression system: E. coli is confirmed effective, though insect cell systems might provide better protein folding for transmembrane proteins.

  • Construct design: Include the full-length sequence (1-565 amino acids) with an N-terminal His tag for purification .

  • Induction conditions: Use lower temperatures (16-20°C) and reduced IPTG concentrations to minimize potential toxicity and improve folding of this transmembrane protein.

  • Membrane fraction isolation: Since PAT21 is a transmembrane protein, careful membrane fraction isolation is critical for maintaining its native conformation.

  • Detergent screening: Test multiple detergents (e.g., DDM, LDAO, Triton X-100) to identify optimal conditions for protein extraction and stability.

What methods are recommended for handling and storing recombinant PAT21?

To maintain the stability and activity of recombinant PAT21:

  • Storage format: Store as a lyophilized powder for long-term stability .

  • Reconstitution: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Long-term storage: Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C, with 50% glycerol being the recommended default concentration .

  • Working conditions: For short-term use, store working aliquots at 4°C for up to one week .

  • Avoid freeze-thaw cycles: Repeated freezing and thawing is not recommended as it may compromise protein activity .

  • Storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 is recommended for maintaining protein stability .

How can researchers assess the enzymatic activity of recombinant PAT21?

To evaluate the S-acyltransferase activity of recombinant PAT21:

  • Metabolic labeling: Incubate cells expressing PAT21 with radiolabeled palmitate (³H or ¹⁴C) and analyze incorporation into target proteins.

  • In vitro S-acylation assay: Use purified recombinant PAT21, potential substrate proteins, and palmitoyl-CoA to measure direct transfer of acyl groups to substrate proteins.

  • Click chemistry approach: Utilize alkyne-modified fatty acids that can be conjugated to fluorescent tags via click chemistry after incorporation, allowing visualization and quantification.

  • Activity comparison: Compare wild-type PAT21 with site-directed mutants targeting the catalytic DHHC domain to confirm the importance of specific residues .

  • Complementation assays: Test whether recombinant PAT21 can rescue phenotypes in atpat21-1 mutant plants, particularly focusing on reproductive development and meiotic progression .

What techniques are effective for studying PAT21's role in meiotic progression?

Based on previous research with PAT21 and meiotic processes:

  • Cytological analysis: Perform detailed microscopic examination of chromosome behavior during meiosis in pollen mother cells using DAPI staining, as conducted in previous studies that revealed chromosome fragmentation and absence of synapsis in pat21 mutants .

  • Immunostaining: Use antibodies against proteins involved in meiotic DSB formation and repair (e.g., RAD51, DMC1, MLH1) to track DNA repair processes in wild-type versus pat21 mutant plants.

  • Genetic interaction studies: Create double mutants between pat21 and key meiotic genes (as done with spo11-1) to dissect specific roles in different aspects of meiosis .

  • Transcriptomics: Apply time-resolved transcriptomics to capture the dynamics of gene expression changes during meiosis in wild-type versus pat21 mutant plants, similar to approaches used in other Arabidopsis studies .

  • Protein localization: Track the localization of PAT21 during different stages of meiosis using fluorescently tagged versions to correlate protein presence with meiotic events.

How might PAT21 function relate to general stress responses in Arabidopsis?

While PAT21 has been primarily characterized for its role in reproduction, the connection between PATs and stress responses warrants investigation:

  • Transcriptional regulation: Studies have shown that Arabidopsis exhibits a general stress response (GSR) characterized by rapid transcriptional reprogramming in response to diverse stressors . The potential role of protein S-acylation in modulating this response, possibly through PAT21, represents an unexplored research avenue.

  • Calcium signaling connection: Given that calcium signaling is central to many stress responses and that certain calcium-permeable channels (like GLUTAMATE RECEPTOR-LIKE proteins) are important in immunity , researchers should investigate whether PAT21-mediated S-acylation affects calcium channel function or localization.

  • CAMTA transcription factors: CAMTAs are major transcriptional regulators of the plant GSR and bind to the core element vCGCGb . Future research could explore whether proteins in the CAMTA signaling pathway are S-acylated by PAT21 or other PATs.

  • Pattern-triggered immunity: The transcriptional response to pattern recognition in plants shows remarkable congruence for different stimuli . Investigating whether PAT21 participates in this response by modifying components of pattern recognition pathways could reveal new functions.

What methodological approaches could identify stress-related substrates of PAT21?

To identify potential stress-related substrates:

  • Comparative proteomics: Compare the S-acylated proteome in wild-type versus pat21 mutant plants under various stress conditions using biotin-switch or acyl-RAC techniques followed by mass spectrometry.

  • Stress-inducible interactions: Employ proximity labeling approaches (BioID or TurboID) with PAT21 as the bait under different stress conditions to capture stress-specific interactors.

  • Transcriptomics integration: Combine transcriptomics data from stress responses with S-acylation proteomics to identify proteins that are both transcriptionally regulated during stress and potentially modified by PAT21.

  • Gene Ontology enrichment: Analyze potential PAT21 substrates for enrichment in stress-related GO terms, particularly those associated with the early general stress response identified in Arabidopsis .

What are the most promising research directions for studying PAT21 function?

For researchers interested in PAT21, the following directions offer significant potential:

  • Comprehensive substrate identification: Systematic identification of PAT21 substrates, particularly those involved in meiotic DNA repair, would significantly advance understanding of how S-acylation regulates reproduction .

  • Structural biology approaches: Determining the three-dimensional structure of PAT21 would provide insights into its substrate recognition and catalytic mechanism, potentially enabling structure-based design of specific modulators.

  • Interplay with other post-translational modifications: Investigating how S-acylation by PAT21 interacts with other modifications (phosphorylation, ubiquitination, etc.) could reveal regulatory networks controlling meiosis and stress responses.

  • Evolutionary conservation: Comparative studies of PAT21 orthologs across plant species could illuminate the evolution of reproductive mechanisms and identify conserved versus species-specific functions.

  • Biotechnological applications: Given PAT21's role in reproduction, exploring its manipulation for agricultural applications, such as controlling plant fertility or enhancing stress resilience, represents a promising translational research direction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.