Recombinant Arabidopsis thaliana Probable S-acyltransferase At3g04970 (At3g04970)

Shipped with Ice Packs
In Stock

Description

Enzymatic Mechanism and Functional Role

At3g04970 follows the canonical PAT catalytic mechanism:

  1. Auto-acylation: The DHHC-CRD domain binds acyl-CoA, transferring the acyl group to a conserved cysteine residue within the enzyme .

  2. Substrate modification: The acyl group is transferred to a cysteine residue on the target protein .

Key functional roles:

  • Regulates abiotic/biotic stress responses by modifying signaling proteins .

  • Facilitates membrane trafficking of cellulose synthase complexes (CESAs) .

  • Essential for proper localization of RIN4 (RPM1-interacting protein 4) in plant immunity .

Production and Purification

Recombinant At3g04970 is produced using multiple expression systems:

Host SystemPurityApplicationsSource
E. coli≥90%Structural studies, enzymatic assays
Yeast/Baculovirus≥85%Functional characterization
Mammalian Cells≥85%Cell-based interaction studies

Purification: Typically involves affinity chromatography (e.g., His-tag) followed by size-exclusion chromatography .

Research Applications

  • Antibody production: Rabbit polyclonal antibodies against At3g04970 enable detection via ELISA and Western blot .

  • Functional studies: Used to identify S-acylation sites in substrates like CBLs (Calcineurin B-like proteins) and CPKs (Calcium-Dependent Protein Kinases) .

  • Structural analysis: Partial recombinant proteins (e.g., 1-286aa) aid in resolving catalytic domains .

Comparative Analysis Within the PAT Family

At3g04970 (PAT17) clusters phylogenetically with other Arabidopsis PATs:

PAT SubfamilyMembersDistinct Features
Group BPAT13-PAT17Membrane-associated, broad substrate range
Group APAT1-PAT9Ankyrin repeat-containing, specialized roles

PAT17 lacks ankyrin repeats but shares conserved motifs (e.g., DHHC-CRD, transmembrane helices) critical for acyltransferase activity .

Challenges and Future Directions

  • Structural resolution: Full-length 3D structure remains unresolved due to transmembrane complexity .

  • Substrate specificity: Mechanisms defining target selection are poorly understood .

  • Biotechnological potential: Optimizing Arabidopsis-based expression systems could enhance yield for industrial applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development with your specified tag.
Synonyms
PAT17; At3g04970; T9J14.8; Probable protein S-acyltransferase 17; Probable palmitoyltransferase At3g04970; Zinc finger DHHC domain-containing protein At3g04970
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-397
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PAT17
Target Protein Sequence
MAVQWLLVCHGMMTLTVVISFLCGQWPIFKGTPFQWIHYFLTFGAYDYFLRFVGFVFGSK GTDVILSVEYFCCDRPNPILQVIYIAIMGSTYFLTAKSSFIYIPGYYLGDVHKYTSFLAV IVGVILFLLTCFSDPGTVNAENVSRYISAYPYDDIIYSKKECSTCKIPKPARSKHCSICN RCVARFDHHCGWMNNCIGERNTKYFMAFLLWHFLLCLYGTVAIGFILAGRVKELRVVHIL TVYYGVDKSFRSLAPRVIQWLVGTYNTQILLMVFLAIVSLLLAGFFAYHANLCLTNTTTN ETFKWREYISLNKKLSEAKASAAALKAGMSCELKKPSAESKCFGLCGRSSAREEEVKADA IAKRNLYDRGSFQNVSEIVFPLSSRPSSSNKSKRKSE
Uniprot No.

Target Background

Function
Palmitoyl acyltransferase.
Database Links

KEGG: ath:AT3G04970

STRING: 3702.AT3G04970.1

UniGene: At.44032

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.

Q&A

What is At3g04970 (PAT17) and what is its molecular function?

At3g04970, also known as PAT17, is a probable protein S-acyltransferase in Arabidopsis thaliana that belongs to the zinc finger DHHC domain-containing protein family. This protein catalyzes the addition of fatty acid chains to cysteine residues of target proteins through a process called S-acylation (also commonly known as palmitoylation). The protein contains 397 amino acids and features a characteristic DHHC motif within its cysteine-rich domain that is essential for its catalytic activity .

S-acylation affects protein localization, stability, and function within the cell. This reversible post-translational modification is particularly important for membrane association and protein trafficking. The DHHC-CRD family is conserved across eukaryotes, with PAT17 being one of approximately 24 predicted PAT proteins in Arabidopsis thaliana .

What are the structural characteristics of recombinant At3g04970 protein?

Recombinant At3g04970 protein (PAT17) has several key structural features:

FeatureDescription
Protein LengthFull Length (1-397 amino acids)
Amino Acid SequenceMAVQWLLVCHGMMTLTVVISFLCGQWPIFKGTPFQWIHYFLTFGAYDYFLRFVGFVFGSK GTDVILSVEYFCCDRPNPILQVIYIAIMGSTYFLTAKSSFIYIPGYYLGDVHKYTSFLAV IVGVILFLLTCFSDPGTVNAENVSRYISAYPYDDIIYSKKECSTCKIPKPARSKHCSICN RCVARFDHHCGWMNNCIGERNTKYFMAFLLWHFLLCLYGTVAIGFILAGRVKELRVVHIL TVYYGVDKSFRSLAPRVIQWLVGTYNTQILLMVFLAIVSLLLAGFFAYHANLCLTNTTTN ETFKWREYISLNKKLSEAKASAAALKAGMSCELKKPSAESKCFGLCGRSSAREEEVKADA IAKRNLYDRGSFQNVSEIVFPLSSRPSSSNKSKRKSE
Transmembrane DomainsMultiple hydrophobic regions suggesting transmembrane domains
Catalytic DomainDHHC-type zinc finger domain critical for S-acyltransferase activity
UniProt IDQ3EBC2
Gene SynonymsPAT17; At3g04970; T9J14.8; Probable protein S-acyltransferase 17; Probable palmitoyltransferase At3g04970

The protein contains multiple transmembrane domains and a DHHC-type zinc finger catalytic domain that is essential for its S-acyltransferase activity . The presence of these transmembrane domains suggests that PAT17 is an integral membrane protein, likely localized to the endomembrane system in plant cells.

What are the optimal conditions for expressing and purifying recombinant At3g04970?

For successful expression and purification of recombinant At3g04970, researchers should consider the following conditions:

  • Expression system: E. coli has been successfully used for the expression of full-length At3g04970 protein .

  • Fusion tags: N-terminal His-tag has been effectively employed for purification purposes .

  • Expression conditions:

    • For membrane proteins like PAT17, lower induction temperatures (16-18°C) often yield better results

    • Consider using specialized E. coli strains optimized for membrane protein expression

    • Inducer concentration should be optimized (typically 0.1-0.5 mM IPTG)

  • Purification considerations:

    • Include appropriate detergents during cell lysis and purification to solubilize membrane proteins

    • Consider using immobilized metal affinity chromatography (IMAC) for His-tagged protein purification

    • Include reducing agents (DTT or TCEP) to prevent oxidation of critical cysteine residues

The final product is typically obtained as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE .

How should recombinant At3g04970 be stored and handled to maintain activity?

Based on product specifications, the following storage and handling guidelines are recommended for maintaining the activity of recombinant At3g04970:

  • Storage temperature: Store at -20°C/-80°C upon receipt .

  • Aliquoting: Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles .

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended, with 50% being the default concentration

  • Working solutions: Working aliquots can be stored at 4°C for up to one week .

  • Long-term stability: Avoid repeated freeze-thaw cycles as they can significantly reduce protein activity .

The storage buffer used for the recombinant protein is a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain protein stability during storage .

What methods can be used to assess the enzymatic activity of At3g04970?

Several complementary approaches can be employed to assess the S-acyltransferase activity of recombinant At3g04970:

  • In vitro acylation assays:

    • Incubate purified At3g04970 with potential substrate proteins and acyl-CoA donors

    • Detection of incorporated fatty acids can be performed using:

      • Metabolic labeling with radioactive palmitate

      • Click chemistry with alkyne/azide-modified fatty acids

      • Mass spectrometry to identify modified peptides

  • Acyl-biotin exchange (ABE) method:

    • Block free thiols with N-ethylmaleimide (NEM)

    • Cleave thioester bonds with hydroxylamine

    • Label newly exposed thiols with biotin-BMCC

    • Detection through Western blotting with streptavidin-HRP

  • Substrate specificity analysis:

    • Test activity with various acyl-CoA donors (varying chain length and saturation)

    • Analyze enzyme kinetics using Michaelis-Menten parameters

    • Compare activity against different candidate substrate proteins

When designing activity assays, it's crucial to include appropriate controls, such as a catalytically inactive mutant (mutation in the DHHC domain) and no-enzyme controls.

How can CRISPR/Cas9 be utilized to study At3g04970 function in Arabidopsis?

CRISPR/Cas9 genome editing offers powerful approaches to investigate At3g04970 function in planta:

  • Knockout strategy:

    • Design guide RNAs targeting exonic regions, preferably the DHHC catalytic domain

    • For At3g04970, target sequences within the coding region should be selected with minimal off-target potential

    • Screen T1 transformants and identify homozygous knockout lines in T2 generation

    • Confirm editing through sequencing and validate absence of protein expression

  • Domain-specific studies:

    • Generate precise point mutations in the DHHC domain to create catalytically inactive variants

    • Create truncation mutants to study domain-specific functions

    • Introduce silent mutations to study the impact of synonymous codons on expression levels

  • Protein tagging:

    • C-terminal or N-terminal fusion with fluorescent proteins or epitope tags

    • Endogenous tagging preserves native expression patterns

    • Consider flexible linkers to minimize disruption of protein function

When analyzing CRISPR-generated mutants, complementation with the wild-type gene should be performed to confirm that phenotypes arise from the targeted modification rather than off-target effects .

What approaches can identify the substrate proteins of At3g04970 in Arabidopsis?

Identifying the substrate proteins of At3g04970 requires a multi-faceted approach:

  • Proteomics-based methods:

    • Comparative S-acylproteome analysis between wild-type and pat17 mutant plants using Acyl-Biotin Exchange coupled with mass spectrometry

    • Quantitative proteomics to identify proteins with decreased S-acylation in pat17 mutants

    • Proximity labeling approaches (BioID, TurboID) to identify proteins in close proximity to PAT17

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with PAT17 antibodies or epitope-tagged versions

    • Yeast two-hybrid screening using catalytically inactive PAT17 as bait

    • Split-ubiquitin assays for membrane protein interactions

    • Bimolecular fluorescence complementation (BiFC) for in vivo validation

  • In vitro validation:

    • Recombinant expression of candidate substrates

    • In vitro S-acylation assays with purified PAT17 and candidates

    • Site-directed mutagenesis of putative S-acylation sites on substrate proteins

Integrated analysis of these approaches allows for high-confidence identification of physiologically relevant PAT17 substrates .

How does At3g04970 function relate to plant stress responses and development?

While specific information about At3g04970's role in stress responses is limited in the provided search results, we can draw insights from research on the broader DHHC-CRD family in plants:

  • Developmental processes:

    • S-acylation mediated by DHHC proteins like TIP1 (another Arabidopsis PAT) affects root hair formation and growth

    • PAT proteins may regulate developmental pathways through S-acylation of signaling proteins

    • Expression analysis of At3g04970 across developmental stages could reveal stage-specific functions

  • Stress signaling pathways:

    • S-acylation affects membrane association of many signaling proteins

    • PAT proteins like PAT10 in Arabidopsis are involved in salt stress responses through modification of calcium signaling proteins

    • Analysis of pat17 mutants under various stress conditions could reveal specific stress-responsive functions

  • Crosstalk with other post-translational modifications:

    • S-acylation can interact with other PTMs like phosphorylation

    • Integrated analysis of the S-acylation and phosphorylation states of potential substrates

    • Investigation of how stress conditions affect this crosstalk

Phenotypic analysis of pat17 mutants under various developmental and stress conditions, coupled with molecular characterization, would provide insights into the specific functions of At3g04970 in these processes.

How can researchers distinguish between direct and indirect effects in At3g04970 mutant phenotypes?

Distinguishing direct from indirect effects in At3g04970 mutant phenotypes requires a systematic approach:

  • Molecular validation strategies:

    • Complementation analysis with wild-type At3g04970 to confirm phenotype rescue

    • Domain-specific mutations to identify catalytically dependent phenotypes

    • Time-course analyses to determine primary versus secondary effects

    • Tissue-specific expression to localize the source of phenotypes

  • Substrate-specific approaches:

    • Identify direct substrates of PAT17 using proteomics

    • Generate mutants in these substrate proteins and compare phenotypes

    • Create site-specific mutations in S-acylation sites of substrates

    • Perform epistasis analysis between pat17 and substrate mutants

  • Network analysis:

    • Transcriptome analysis of pat17 mutants to identify affected pathways

    • Metabolome analysis to detect broader metabolic changes

    • Integration with protein-protein interaction networks

    • Comparison with phenotypes of other PAT family mutants to identify shared versus unique effects

When reporting results, clearly distinguish observations from interpretations, and consider multiple alternative hypotheses to explain complex phenotypes.

How should contradictory findings about At3g04970 be reconciled in the literature?

When faced with contradictory findings about At3g04970 in the literature, researchers should:

  • Methodological comparison:

    • Carefully evaluate differences in experimental methods

    • Consider variations in expression systems (heterologous vs. endogenous)

    • Assess differences in protein tagging strategies (tag type, position)

    • Examine differences in assay conditions that might affect activity

  • Biological context analysis:

    • Compare plant growth conditions and developmental stages

    • Evaluate differences in genetic backgrounds

    • Consider tissue-specific variations in function

    • Assess potential functional redundancy with other PAT proteins

  • Integrative approaches:

    • Design experiments that directly test contradictory claims

    • Combine multiple methodologies to provide complementary evidence

    • Consider meta-analysis of published data when appropriate

    • Engage with authors of contradictory studies to identify potential sources of variation

  • Reporting considerations:

    • Clearly acknowledge contradictions in the literature

    • Present alternative interpretations of data

    • Avoid confirmation bias by giving fair consideration to all evidence

    • Propose specific experiments that could resolve contradictions

By systematically addressing these aspects, researchers can develop a more nuanced understanding of At3g04970 function and reconcile apparently contradictory findings.

What reference data should researchers use when working with At3g04970?

ParameterValueSource/Method
Gene IdentifierAt3g04970The Arabidopsis Information Resource (TAIR)
Protein Length397 amino acidsUniProt (Q3EBC2)
SynonymsPAT17; T9J14.8; Probable protein S-acyltransferase 17; Probable palmitoyltransferase At3g04970; Zinc finger DHHC domain-containing protein At3g04970UniProt
UniProt IDQ3EBC2UniProt Database
Protein FamilyDHHC-type zinc finger family proteinTAIR annotation
Gene OntologyProtein S-acyltransferase activity; Zinc ion binding; Transferase activityGene Ontology Database
Expression PatternVariable across tissues and developmental stagesExpression databases (Genevestigator, eFP Browser)
Subcellular LocalizationPredicted membrane protein, likely endomembrane systemBased on sequence features
Optimal Storage-20°C/-80°C in Tris/PBS buffer with 6% Trehalose, pH 8.0Product specifications

This reference data provides a solid foundation for experimental design and interpretation when working with At3g04970.

What protein purification protocols yield the highest activity of recombinant At3g04970?

Based on available information, the following purification protocol is recommended for obtaining high-activity recombinant At3g04970:

  • Expression conditions:

    • E. coli expression system with N-terminal His tag

    • Growth at lower temperatures after induction (16-18°C)

    • Harvest cells by centrifugation when OD600 reaches optimal level

  • Cell lysis and initial purification:

    • Resuspend cells in lysis buffer containing appropriate detergents

    • Include protease inhibitors to prevent degradation

    • Clarify lysate by high-speed centrifugation

    • Perform IMAC using Ni-NTA or similar resin

  • Further purification steps:

    • Consider size exclusion chromatography to improve purity

    • Dialyze against storage buffer (Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

    • Concentrate to desired final concentration

  • Quality control:

    • Verify purity by SDS-PAGE (>90% purity expected)

    • Confirm identity by Western blot or mass spectrometry

    • Assess activity using standard S-acyltransferase assays

  • Storage and handling:

    • Lyophilize for long-term storage

    • Aliquot to avoid freeze-thaw cycles

    • Store at -20°C/-80°C

    • For working stocks, store at 4°C for up to one week

Following reconstitution, the protein should be used in a buffer system optimized for S-acyltransferase activity, typically including reducing agents and appropriate metal cofactors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.