At3g04970 follows the canonical PAT catalytic mechanism:
Auto-acylation: The DHHC-CRD domain binds acyl-CoA, transferring the acyl group to a conserved cysteine residue within the enzyme .
Substrate modification: The acyl group is transferred to a cysteine residue on the target protein .
Regulates abiotic/biotic stress responses by modifying signaling proteins .
Facilitates membrane trafficking of cellulose synthase complexes (CESAs) .
Essential for proper localization of RIN4 (RPM1-interacting protein 4) in plant immunity .
Recombinant At3g04970 is produced using multiple expression systems:
| Host System | Purity | Applications | Source |
|---|---|---|---|
| E. coli | ≥90% | Structural studies, enzymatic assays | |
| Yeast/Baculovirus | ≥85% | Functional characterization | |
| Mammalian Cells | ≥85% | Cell-based interaction studies |
Purification: Typically involves affinity chromatography (e.g., His-tag) followed by size-exclusion chromatography .
Antibody production: Rabbit polyclonal antibodies against At3g04970 enable detection via ELISA and Western blot .
Functional studies: Used to identify S-acylation sites in substrates like CBLs (Calcineurin B-like proteins) and CPKs (Calcium-Dependent Protein Kinases) .
Structural analysis: Partial recombinant proteins (e.g., 1-286aa) aid in resolving catalytic domains .
At3g04970 (PAT17) clusters phylogenetically with other Arabidopsis PATs:
| PAT Subfamily | Members | Distinct Features |
|---|---|---|
| Group B | PAT13-PAT17 | Membrane-associated, broad substrate range |
| Group A | PAT1-PAT9 | Ankyrin repeat-containing, specialized roles |
PAT17 lacks ankyrin repeats but shares conserved motifs (e.g., DHHC-CRD, transmembrane helices) critical for acyltransferase activity .
Structural resolution: Full-length 3D structure remains unresolved due to transmembrane complexity .
Substrate specificity: Mechanisms defining target selection are poorly understood .
Biotechnological potential: Optimizing Arabidopsis-based expression systems could enhance yield for industrial applications .
At3g04970, also known as PAT17, is a probable protein S-acyltransferase in Arabidopsis thaliana that belongs to the zinc finger DHHC domain-containing protein family. This protein catalyzes the addition of fatty acid chains to cysteine residues of target proteins through a process called S-acylation (also commonly known as palmitoylation). The protein contains 397 amino acids and features a characteristic DHHC motif within its cysteine-rich domain that is essential for its catalytic activity .
S-acylation affects protein localization, stability, and function within the cell. This reversible post-translational modification is particularly important for membrane association and protein trafficking. The DHHC-CRD family is conserved across eukaryotes, with PAT17 being one of approximately 24 predicted PAT proteins in Arabidopsis thaliana .
Recombinant At3g04970 protein (PAT17) has several key structural features:
| Feature | Description |
|---|---|
| Protein Length | Full Length (1-397 amino acids) |
| Amino Acid Sequence | MAVQWLLVCHGMMTLTVVISFLCGQWPIFKGTPFQWIHYFLTFGAYDYFLRFVGFVFGSK GTDVILSVEYFCCDRPNPILQVIYIAIMGSTYFLTAKSSFIYIPGYYLGDVHKYTSFLAV IVGVILFLLTCFSDPGTVNAENVSRYISAYPYDDIIYSKKECSTCKIPKPARSKHCSICN RCVARFDHHCGWMNNCIGERNTKYFMAFLLWHFLLCLYGTVAIGFILAGRVKELRVVHIL TVYYGVDKSFRSLAPRVIQWLVGTYNTQILLMVFLAIVSLLLAGFFAYHANLCLTNTTTN ETFKWREYISLNKKLSEAKASAAALKAGMSCELKKPSAESKCFGLCGRSSAREEEVKADA IAKRNLYDRGSFQNVSEIVFPLSSRPSSSNKSKRKSE |
| Transmembrane Domains | Multiple hydrophobic regions suggesting transmembrane domains |
| Catalytic Domain | DHHC-type zinc finger domain critical for S-acyltransferase activity |
| UniProt ID | Q3EBC2 |
| Gene Synonyms | PAT17; At3g04970; T9J14.8; Probable protein S-acyltransferase 17; Probable palmitoyltransferase At3g04970 |
The protein contains multiple transmembrane domains and a DHHC-type zinc finger catalytic domain that is essential for its S-acyltransferase activity . The presence of these transmembrane domains suggests that PAT17 is an integral membrane protein, likely localized to the endomembrane system in plant cells.
For successful expression and purification of recombinant At3g04970, researchers should consider the following conditions:
Expression system: E. coli has been successfully used for the expression of full-length At3g04970 protein .
Fusion tags: N-terminal His-tag has been effectively employed for purification purposes .
Expression conditions:
For membrane proteins like PAT17, lower induction temperatures (16-18°C) often yield better results
Consider using specialized E. coli strains optimized for membrane protein expression
Inducer concentration should be optimized (typically 0.1-0.5 mM IPTG)
Purification considerations:
Include appropriate detergents during cell lysis and purification to solubilize membrane proteins
Consider using immobilized metal affinity chromatography (IMAC) for His-tagged protein purification
Include reducing agents (DTT or TCEP) to prevent oxidation of critical cysteine residues
The final product is typically obtained as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE .
Based on product specifications, the following storage and handling guidelines are recommended for maintaining the activity of recombinant At3g04970:
Aliquoting: Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles .
Reconstitution protocol:
Working solutions: Working aliquots can be stored at 4°C for up to one week .
Long-term stability: Avoid repeated freeze-thaw cycles as they can significantly reduce protein activity .
The storage buffer used for the recombinant protein is a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain protein stability during storage .
Several complementary approaches can be employed to assess the S-acyltransferase activity of recombinant At3g04970:
In vitro acylation assays:
Incubate purified At3g04970 with potential substrate proteins and acyl-CoA donors
Detection of incorporated fatty acids can be performed using:
Metabolic labeling with radioactive palmitate
Click chemistry with alkyne/azide-modified fatty acids
Mass spectrometry to identify modified peptides
Acyl-biotin exchange (ABE) method:
Block free thiols with N-ethylmaleimide (NEM)
Cleave thioester bonds with hydroxylamine
Label newly exposed thiols with biotin-BMCC
Detection through Western blotting with streptavidin-HRP
Substrate specificity analysis:
Test activity with various acyl-CoA donors (varying chain length and saturation)
Analyze enzyme kinetics using Michaelis-Menten parameters
Compare activity against different candidate substrate proteins
When designing activity assays, it's crucial to include appropriate controls, such as a catalytically inactive mutant (mutation in the DHHC domain) and no-enzyme controls.
CRISPR/Cas9 genome editing offers powerful approaches to investigate At3g04970 function in planta:
Knockout strategy:
Design guide RNAs targeting exonic regions, preferably the DHHC catalytic domain
For At3g04970, target sequences within the coding region should be selected with minimal off-target potential
Screen T1 transformants and identify homozygous knockout lines in T2 generation
Confirm editing through sequencing and validate absence of protein expression
Domain-specific studies:
Generate precise point mutations in the DHHC domain to create catalytically inactive variants
Create truncation mutants to study domain-specific functions
Introduce silent mutations to study the impact of synonymous codons on expression levels
Protein tagging:
C-terminal or N-terminal fusion with fluorescent proteins or epitope tags
Endogenous tagging preserves native expression patterns
Consider flexible linkers to minimize disruption of protein function
When analyzing CRISPR-generated mutants, complementation with the wild-type gene should be performed to confirm that phenotypes arise from the targeted modification rather than off-target effects .
Identifying the substrate proteins of At3g04970 requires a multi-faceted approach:
Proteomics-based methods:
Comparative S-acylproteome analysis between wild-type and pat17 mutant plants using Acyl-Biotin Exchange coupled with mass spectrometry
Quantitative proteomics to identify proteins with decreased S-acylation in pat17 mutants
Proximity labeling approaches (BioID, TurboID) to identify proteins in close proximity to PAT17
Protein-protein interaction studies:
Co-immunoprecipitation with PAT17 antibodies or epitope-tagged versions
Yeast two-hybrid screening using catalytically inactive PAT17 as bait
Split-ubiquitin assays for membrane protein interactions
Bimolecular fluorescence complementation (BiFC) for in vivo validation
In vitro validation:
Recombinant expression of candidate substrates
In vitro S-acylation assays with purified PAT17 and candidates
Site-directed mutagenesis of putative S-acylation sites on substrate proteins
Integrated analysis of these approaches allows for high-confidence identification of physiologically relevant PAT17 substrates .
While specific information about At3g04970's role in stress responses is limited in the provided search results, we can draw insights from research on the broader DHHC-CRD family in plants:
Developmental processes:
S-acylation mediated by DHHC proteins like TIP1 (another Arabidopsis PAT) affects root hair formation and growth
PAT proteins may regulate developmental pathways through S-acylation of signaling proteins
Expression analysis of At3g04970 across developmental stages could reveal stage-specific functions
Stress signaling pathways:
S-acylation affects membrane association of many signaling proteins
PAT proteins like PAT10 in Arabidopsis are involved in salt stress responses through modification of calcium signaling proteins
Analysis of pat17 mutants under various stress conditions could reveal specific stress-responsive functions
Crosstalk with other post-translational modifications:
S-acylation can interact with other PTMs like phosphorylation
Integrated analysis of the S-acylation and phosphorylation states of potential substrates
Investigation of how stress conditions affect this crosstalk
Phenotypic analysis of pat17 mutants under various developmental and stress conditions, coupled with molecular characterization, would provide insights into the specific functions of At3g04970 in these processes.
Distinguishing direct from indirect effects in At3g04970 mutant phenotypes requires a systematic approach:
Molecular validation strategies:
Complementation analysis with wild-type At3g04970 to confirm phenotype rescue
Domain-specific mutations to identify catalytically dependent phenotypes
Time-course analyses to determine primary versus secondary effects
Tissue-specific expression to localize the source of phenotypes
Substrate-specific approaches:
Identify direct substrates of PAT17 using proteomics
Generate mutants in these substrate proteins and compare phenotypes
Create site-specific mutations in S-acylation sites of substrates
Perform epistasis analysis between pat17 and substrate mutants
Network analysis:
Transcriptome analysis of pat17 mutants to identify affected pathways
Metabolome analysis to detect broader metabolic changes
Integration with protein-protein interaction networks
Comparison with phenotypes of other PAT family mutants to identify shared versus unique effects
When reporting results, clearly distinguish observations from interpretations, and consider multiple alternative hypotheses to explain complex phenotypes.
When faced with contradictory findings about At3g04970 in the literature, researchers should:
Methodological comparison:
Carefully evaluate differences in experimental methods
Consider variations in expression systems (heterologous vs. endogenous)
Assess differences in protein tagging strategies (tag type, position)
Examine differences in assay conditions that might affect activity
Biological context analysis:
Compare plant growth conditions and developmental stages
Evaluate differences in genetic backgrounds
Consider tissue-specific variations in function
Assess potential functional redundancy with other PAT proteins
Integrative approaches:
Design experiments that directly test contradictory claims
Combine multiple methodologies to provide complementary evidence
Consider meta-analysis of published data when appropriate
Engage with authors of contradictory studies to identify potential sources of variation
Reporting considerations:
Clearly acknowledge contradictions in the literature
Present alternative interpretations of data
Avoid confirmation bias by giving fair consideration to all evidence
Propose specific experiments that could resolve contradictions
By systematically addressing these aspects, researchers can develop a more nuanced understanding of At3g04970 function and reconcile apparently contradictory findings.
This reference data provides a solid foundation for experimental design and interpretation when working with At3g04970.
Based on available information, the following purification protocol is recommended for obtaining high-activity recombinant At3g04970:
Expression conditions:
Cell lysis and initial purification:
Resuspend cells in lysis buffer containing appropriate detergents
Include protease inhibitors to prevent degradation
Clarify lysate by high-speed centrifugation
Perform IMAC using Ni-NTA or similar resin
Further purification steps:
Quality control:
Storage and handling:
Following reconstitution, the protein should be used in a buffer system optimized for S-acyltransferase activity, typically including reducing agents and appropriate metal cofactors.