Recombinant Arabidopsis thaliana Probable S-acyltransferase At3g09320 (At3g09320)

What is the structural composition of Recombinant Arabidopsis thaliana Probable S-acyltransferase At3G09320?

Recombinant Arabidopsis thaliana Probable S-acyltransferase At3G09320 (PAT16) is a full-length protein consisting of 286 amino acids. The protein contains a zinc finger DHHC domain, which is characteristic of S-acyltransferases. When produced recombinantly, it's typically expressed with an N-terminal His tag to facilitate purification and detection. The complete amino acid sequence is: MKRKGVGFSLPVTVVMLVIGFIYFASVFTFIDRWFSLTSSPGIANAAAFTALALMCIYNY SIAVFRDPGRVPLNYMPDVEDPESPVHEIKRKGGDLRYCQKCSHFKPPRAHHCRVCKRCV LRMDHHCIWINNCVGHTNYKVFFVFVVYAVTACVYSLVLLVGSLTVEPQDEEEEMGSYLR TIYVISAFLLIPLSIALGVLLGWHIYLILQNKTTIEYHEGVRAMWLAEKGGQVYKHPYDI GAYENLTLILGPNILSWLCPTSRHIGSGVRFRTAFDSIPDSSETKH . The protein features transmembrane domains consistent with its predicted membrane localization and enzymatic function.

What are the alternative names and identifiers for the At3G09320 protein?

Researchers should be aware of multiple nomenclature variants when searching literature and databases for this protein:

This protein belongs to the S-acyltransferase family, specifically functioning as a probable palmitoyltransferase in Arabidopsis thaliana . When citing this protein in publications, it's recommended to use both the locus identifier (At3G09320) and the functional name (Probable S-acyltransferase) to ensure clarity across different research contexts.

What expression systems are commonly used for producing this recombinant protein?

The recombinant Arabidopsis thaliana Probable S-acyltransferase At3G09320 is predominantly expressed in E. coli expression systems. This bacterial expression platform offers advantages for producing plant proteins, including high yield, relatively simple purification protocols, and compatibility with His-tag fusion strategies. The protein is typically expressed as a full-length construct (amino acids 1-286) with an N-terminal histidine tag to facilitate purification via affinity chromatography . While E. coli remains the standard expression system, some researchers may encounter challenges with membrane protein folding and post-translational modifications. Alternative expression systems such as yeast or insect cells might be considered for specific applications requiring eukaryotic folding machinery, though these approaches are not as commonly documented for this particular protein.

What are the optimal storage and reconstitution conditions for preserving At3G09320 protein activity?

Proper storage and reconstitution are critical for maintaining the functional integrity of the At3G09320 protein. The recombinant protein is typically supplied as a lyophilized powder, which provides stability during shipping and long-term storage. For optimal results, researchers should follow these evidence-based protocols:

Storage Conditions:

• Store the lyophilized protein at -20°C to -80°C immediately upon receipt

• For extended storage periods, -80°C is preferred to minimize degradation

• Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

• Working aliquots can be stored at 4°C for up to one week

• Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

Reconstitution Protocol:

• Briefly centrifuge the vial to collect the protein at the bottom before opening

• Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 50% for long-term storage (acceptable range: 5-50%)

• The reconstituted protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Following these handling guidelines will help ensure experimental reproducibility and maintain the protein's catalytic activity across multiple experimental sessions.

How can researchers verify the purity and activity of recombinant At3G09320 protein?

Verifying both purity and enzymatic activity of recombinant At3G09320 is essential before proceeding with functional studies. A multi-method approach is recommended:

Purity Assessment:

• SDS-PAGE analysis: Commercial preparations typically show >90% purity as determined by SDS-PAGE . Run the protein alongside appropriate molecular weight markers and look for a predominant band at approximately 32-35 kDa (accounting for the His-tag).

• Western blotting: Use anti-His antibodies to confirm the presence of the tagged protein.

• Mass spectrometry: For precise characterization, peptide mass fingerprinting can provide definitive identification.

Activity Verification:

• S-acyltransferase activity assay: Measure the transfer of acyl groups (typically palmitoyl) from acyl-CoA to target proteins.

• In vitro palmitoylation assay: Using radiolabeled palmitoyl-CoA or click chemistry-compatible palmitoyl analogs.

• Target protein interaction studies: Verify binding to known substrate proteins through co-immunoprecipitation or in vitro binding assays.

A common challenge in activity verification is distinguishing between true enzymatic activity and non-specific effects. Including proper negative controls (heat-inactivated enzyme, catalytically inactive mutants) and positive controls (commercial S-acyltransferases) is essential for meaningful interpretation of activity data.

What methods can be used to study protein-protein interactions involving At3G09320?

Investigating protein-protein interactions is crucial for understanding the biological function and regulatory networks of At3G09320. Several complementary techniques can be employed:

In Vitro Methods:

• Pull-down assays using His-tagged At3G09320 as bait protein

• Surface Plasmon Resonance (SPR) for real-time binding kinetics analysis

• Isothermal Titration Calorimetry (ITC) for thermodynamic characterization of interactions

In Vivo/Cell-Based Methods:

• Yeast two-hybrid (Y2H) screening to identify novel interaction partners

• Split-ubiquitin membrane yeast two-hybrid (specifically for membrane proteins)

• Bimolecular Fluorescence Complementation (BiFC) for visualizing interactions in plant cells

• Co-immunoprecipitation followed by mass spectrometry for unbiased interaction partner identification

Proximity-Based Methods:

• Proximity-dependent biotin identification (BioID) adapted for plant systems

• Cross-linking mass spectrometry (XL-MS) for detecting transient interactions

When designing protein interaction studies, researchers should consider the membrane-associated nature of At3G09320 and include appropriate detergents or membrane-mimetic systems to maintain protein folding and accessibility. Additionally, confirming interactions through multiple independent methods significantly strengthens confidence in the results.

How does the enzymatic activity of At3G09320 compare with other S-acyltransferases in Arabidopsis?

Arabidopsis thaliana contains a family of S-acyltransferases with varying substrate specificities and tissue expression patterns. Comparative analysis reveals distinctive features of At3G09320 (PAT16):

At3G09320 exhibits mid-range catalytic efficiency compared to other Arabidopsis S-acyltransferases, with a preference for membrane-associated protein substrates. The zinc finger DHHC domain in At3G09320 shares structural similarity with other family members but contains unique residues that likely contribute to its substrate specificity profile. When designing experiments to characterize this enzyme, researchers should consider using comparative approaches against other family members to highlight its unique properties and potential redundancies in biological systems.

What are the methodological considerations for analyzing At3G09320 knockout/knockdown phenotypes?

Analyzing the phenotypic consequences of At3G09320 disruption requires careful experimental design and multiple complementary approaches:

Genetic Disruption Strategies:

• T-DNA insertion lines: Screen homozygous lines with insertions in different regions of the gene

• CRISPR/Cas9-mediated mutagenesis: Design guide RNAs targeting conserved domains

• Artificial microRNA (amiRNA): Develop constructs targeting unique regions of At3G09320 mRNA

• Inducible RNAi: Use estrogen or dexamethasone-inducible systems for temporal control

Phenotypic Characterization Approaches:

• Morphological analysis across developmental stages

• Subcellular protein localization changes using fluorescent protein fusions

• Biochemical assessment of palmitoylation status of putative target proteins

• Transcriptome analysis to identify affected pathways

• Metabolomic analysis focusing on lipid-related metabolites

Control Considerations:

• Use multiple independent knockout/knockdown lines

• Include complementation studies with wild-type At3G09320 to confirm phenotype specificity

• Design experiments to distinguish from potential redundancy with other S-acyltransferases

• Consider genetic background effects that might influence phenotypic expression

A critical aspect of phenotypic analysis is distinguishing direct effects of At3G09320 disruption from secondary consequences. Time-course experiments and tissue-specific analyses can help establish the primary mechanistic impacts versus downstream developmental adaptations.

How can researchers accurately quantify changes in protein S-acylation mediated by At3G09320?

Quantifying protein S-acylation changes requires sophisticated analytical techniques. The following methodological approaches are recommended for researchers studying At3G09320-mediated S-acylation:

Metabolic Labeling Approaches:

• Pulse-chase with radiolabeled palmitate (³H or ¹⁴C)

• Bioorthogonal labeling with alkyne/azide-modified fatty acids (click chemistry)

• Stable isotope labeling with amino acids in cell culture (SILAC) combined with acyl-biotin exchange

Acyl-Biotin Exchange (ABE) Methodology:

• Blockade of free thiols with N-ethylmaleimide (NEM)

• Selective cleavage of thioester bonds with hydroxylamine

• Biotinylation of newly exposed thiols

• Enrichment with streptavidin and detection by immunoblotting or mass spectrometry

Mass Spectrometry-Based Approaches:

• Direct detection of palmitoylated peptides

• Quantitative proteomics comparing wild-type and At3G09320 mutant plants

• Site-specific analysis using specialized fragmentation techniques

The experimental design should include both positive controls (known palmitoylated proteins) and negative controls (proteins not subject to S-acylation) to establish the dynamic range and specificity of the assay. Additionally, researchers should be aware of potential non-enzymatic S-acylation events and distinguish these from At3G09320-specific activity through careful control experiments.

What statistical approaches are most appropriate for analyzing At3G09320 functional data?

For Enzymatic Activity Data:

For Phenotypic Analysis:

• Mixed-effects models for time-series developmental phenotypes

• False discovery rate (FDR) correction for multiple testing in omics datasets

• Principal component analysis (PCA) for identifying major sources of variation

• Permutation tests for complex phenotypic datasets with potential non-normal distributions

For Protein-Protein Interaction Data:

• Significance estimation for pull-down experiments using quantitative proteomics

• Network analysis algorithms for interpreting protein interaction networks

• Enrichment analysis for functional categorization of interaction partners

The complexity of biological systems often necessitates sophisticated statistical approaches. Researchers should prioritize transparent reporting of statistical methods, including assumptions testing, sample size justification, and effect size estimation to ensure reproducibility and meaningful interpretation of At3G09320 functional data.

How can researchers address potential redundancy between At3G09320 and other S-acyltransferases?

Functional redundancy among plant S-acyltransferases presents a significant challenge for researchers studying At3G09320. To address this issue effectively, consider implementing these methodological strategies:

Genetic Approaches:

• Generate higher-order mutants combining At3G09320 disruption with related S-acyltransferases

• Create conditional knockdown systems targeting multiple family members simultaneously

• Employ tissue-specific or inducible promoters to examine context-dependent redundancy

Biochemical Differentiation:

• Perform detailed substrate specificity profiling using protein arrays or candidate approaches

• Compare subcellular localization patterns through fluorescent protein fusions

• Conduct domain-swapping experiments to identify regions conferring functional specificity

Systems Biology Approaches:

• Transcriptome co-expression analysis to identify unique vs. shared regulatory networks

• Interactome mapping to distinguish unique protein interaction partners

• Large-scale palmitoylation profiling in single and combinatorial mutant backgrounds

What are the best practices for experimental design when studying At3G09320's role in developmental processes?

Investigating At3G09320's role in plant development requires rigorous experimental design strategies:

Temporal Considerations:

• Implement stage-specific sampling across multiple developmental phases

• Use inducible expression/suppression systems for temporal control

• Design time-course experiments with appropriate statistical power for each time point

• Consider circadian and diurnal variations in expression and activity

Spatial Considerations:

• Employ tissue-specific promoters for targeted genetic manipulation

• Use cell-type specific reporters to track expression patterns

• Implement laser-capture microdissection for tissue-specific biochemical analysis

• Consider three-dimensional organ development using appropriate imaging techniques

Environmental Variables:

• Control environmental conditions precisely across experiments

• Test developmental phenotypes under multiple growth conditions

• Consider stress responses that might reveal conditional phenotypes

• Implement factorial experimental designs to identify interaction effects

Experimental Controls:

• Include multiple allelic variants of At3G09320 disruption

• Implement complementation studies with the native promoter

• Create catalytically inactive versions to distinguish between enzymatic and structural roles

• Develop reporter fusions that maintain full protein functionality

The table below outlines a recommended sampling strategy for developmental analysis:

This comprehensive approach enables researchers to distinguish primary developmental roles from secondary effects and contextualizes At3G09320 function within the broader developmental program.

How does the function of At3G09320 compare across different plant species?

Evolutionary conservation analysis provides valuable insights into the functional significance of At3G09320. Comparative genomics approaches reveal:

The S. latifolia expressed sequence tag (EST) database contains a partial sequence with approximately 73% identity to At3G09320, suggesting conservation across diverse plant families . The high degree of sequence conservation in the catalytic DHHC domain indicates functional constraint through evolution.

When designing comparative studies, researchers should consider:

• Using complementation assays with orthologs to test functional conservation

• Examining expression patterns across species to identify conserved regulatory mechanisms

• Comparing substrate specificity between orthologs to understand evolutionary divergence

• Analyzing selective pressure on different protein domains to identify regions under positive selection

Cross-species analyses can reveal evolutionarily conserved functions that likely represent core biological roles of At3G09320 as well as species-specific adaptations that may reflect specialized functions.

What emerging technologies could advance our understanding of At3G09320 function?

Several cutting-edge technologies hold promise for deeper mechanistic insights into At3G09320 function:

Advanced Imaging Approaches:

• Super-resolution microscopy for precise subcellular localization

• Cryo-electron microscopy for structural determination

• Single-molecule tracking to monitor dynamic protein behavior in vivo

• FRET-based biosensors to monitor S-acylation in real-time

Genome Engineering Advances:

• Base editing for introducing specific point mutations

• Prime editing for precise sequence modifications

• CRISPR activation/interference for modulating expression without genetic modification

• Tissue-specific genome editing using cell type-specific promoters

Proteomics Innovations:

• Thermal proteome profiling for monitoring protein-small molecule interactions

• Hydrogen-deuterium exchange mass spectrometry for protein dynamics

• Cross-linking mass spectrometry for mapping protein interaction interfaces

• Top-down proteomics for characterizing intact proteoforms

Computational Approaches:

• AlphaFold2-based structural predictions and docking simulations

• Molecular dynamics simulations of enzyme-substrate interactions

• Machine learning for predicting substrate specificity

• Systems biology modeling of S-acylation networks

Implementing these technologies will require interdisciplinary collaborations and careful experimental design but offers the potential to resolve long-standing questions about At3G09320's enzymatic mechanism, substrate selection, and biological function.

What are the most promising research directions for understanding At3G09320's role in plant stress responses?

Emerging evidence suggests S-acyltransferases play important roles in plant stress adaptation. Future research on At3G09320's involvement in stress responses should consider:

Abiotic Stress Investigations:

• Analyze expression changes under diverse stress conditions (drought, salt, temperature extremes)

• Monitor dynamic changes in S-acylation patterns during stress adaptation

• Investigate potential role in stress-responsive membrane protein trafficking

• Examine alterations in lipid raft composition and membrane microdomain organization

Biotic Stress Responses:

• Investigate potential roles in pathogen recognition receptor regulation

• Analyze impacts on defense signaling protein localization and activity

• Examine potential roles in symbiotic interactions with beneficial microbes

• Study changes in S-acylation patterns during immune responses

Cross-Talk with Hormone Signaling:

• Investigate interactions with abscisic acid signaling components

• Analyze connections to jasmonate-mediated stress responses

• Examine potential regulation by stress-responsive hormones

• Study effects on hormone receptor trafficking and localization

Methodological Approaches:

• Conduct phenotypic analysis under diverse stress conditions

• Implement quantitative proteomics to identify stress-specific S-acylation targets

• Perform comparative analyses with stress-responsive S-acyltransferases

• Develop stress-specific reporters to monitor At3G09320 activity in vivo

Understanding At3G09320's role in stress adaptation has potential translational applications for developing stress-resilient crops through targeted modification of S-acylation pathways. Research in this direction should prioritize both mechanistic understanding and potential agricultural applications.