The Arabidopsis thaliana At3g18620 gene encodes a protein formally classified as a Probable S-acyltransferase, also known by several synonyms in scientific literature. The protein has been characterized and cataloged with specific identifiers that enable consistent reference across scientific databases and research publications.
Table 1: Protein Identification Information
| Parameter | Details |
|---|---|
| Protein Name | Probable S-acyltransferase At3g18620 |
| Gene Name | PAT11 |
| Synonyms | Protein S-acyltransferase 11; Probable palmitoyltransferase At3g18620; Zinc finger DHHC domain-containing protein At3g18620 |
| UniProt ID | Q9LIH7 |
| Locus Tag | At3g18620; K24M9.11 |
This protein belongs to the family of protein S-acyltransferases (PATs), which are enzymes responsible for catalyzing protein S-acylation, a post-translational lipid modification process in eukaryotes . Within the Arabidopsis thaliana genome, twenty putative PAT genes have been identified, with At3g18620 representing one member of this diverse protein family . The classification as a "probable" S-acyltransferase indicates that while structural and sequence analyses strongly suggest this enzymatic function, definitive experimental validation of its catalytic activity may still be developing in scientific literature.
As a probable S-acyltransferase, At3g18620 is believed to catalyze the addition of fatty acid groups (primarily palmitate) to specific cysteine residues in target proteins through thioester bonds . This post-translational modification, known as S-acylation or palmitoylation, plays critical roles in regulating protein localization, stability, and function.
The catalytic mechanism of PAT enzymes typically involves several conserved residues within the DHHC domain. Studies on related acyltransferases have identified critical tyrosine residues that are essential for enzymatic function . These residues participate in the transfer of acyl groups from acyl-CoA donors to the substrate proteins.
S-acylation is a dynamic and reversible modification, with the cycle of S-acylation and de-S-acylation providing a molecular mechanism for membrane-associated proteins to undergo cycling and trafficking between different cellular compartments . This reversibility serves as a molecular switch that can initiate or terminate particular signaling transductions on the membrane surface.
Research on the expression patterns of putative PAT genes in Arabidopsis thaliana has revealed distinct tissue-specific expression profiles, suggesting specialized functions for each family member . While the search results do not provide specific expression data for At3g18620 (PAT11) individually, the analysis of the PAT gene family in Arabidopsis indicates that these genes show varied expression across different tissues and developmental stages.
The expression patterns of PAT genes suggest that each member of the family might have different biological functions in various tissues and developmental stages in Arabidopsis thaliana . Some PAT genes show preferential expression in specific tissues such as seedlings, flowers, roots, or siliques, while others display more ubiquitous expression patterns.
Protein S-acylation mediated by PAT enzymes like At3g18620 plays critical roles in a variety of protein functions involved in plant development and responses to abiotic and biotic stresses . The dynamic nature of S-acylation provides a regulatory mechanism for proteins involved in signal transduction pathways.
S-acylated proteins in plants are involved in various cellular processes, including:
Membrane association and protein trafficking
Signal transduction pathways
Responses to environmental stresses
Plant development and growth regulation
The identification and characterization of At3g18620 as a probable S-acyltransferase contribute to our understanding of these important biological processes in plants. Further research into substrate specificity and regulatory mechanisms will provide deeper insights into the specific roles of this protein in Arabidopsis thaliana.
The At3g18620 protein belongs to a family of twenty putative PAT genes identified in the Arabidopsis thaliana genome . Phylogenetic analysis based on cDNA sequences has allowed classification of these proteins into distinct groups with potentially different functional roles.
The diverse expression patterns observed among PAT family members suggest functional specialization, with different PATs potentially targeting specific subsets of substrate proteins or functioning in specific tissues or developmental contexts . This diversity highlights the complexity of protein S-acylation regulatory networks in plants.
The availability of recombinant At3g18620 protein opens numerous possibilities for research applications, including:
Structural studies to determine the three-dimensional conformation of the protein
Enzymatic assays to characterize catalytic activity and substrate specificity
Protein-protein interaction studies to identify binding partners and regulatory proteins
Generation of antibodies for immunolocalization and expression studies
The high purity and defined specifications of the recombinant protein ensure reliable and reproducible results in these experimental applications .
Understanding the function of PAT enzymes like At3g18620 may have broader implications beyond plant biology. Research on protein S-acylation has potential implications for understanding plant-pathogen interactions and other biological processes affected by post-translational lipid modifications .
Further detailed characterization of putative PATs in Arabidopsis could provide insights into mechanisms affecting various biological processes, potentially informing biotechnological applications in crop improvement or stress resistance.
At3g18620 is classified as a probable S-acyltransferase (EC 2.3.1.-) in Arabidopsis thaliana, containing a characteristic zinc finger DHHC domain that is critical for its catalytic function. The protein consists of 345 amino acids with a full sequence that includes multiple transmembrane domains and the conserved DHHC motif essential for palmitoyltransferase activity . The protein's amino acid sequence (MEDSSQGSFVATINEDYEAICWGCGLNLVLPSYAPVFKCGWCGAITNQNPVRPETKSFGLRRFRDRCFVVILAVFMLFVICGGIWAAYPVLFSISLACGIFHSVTTATLAISTSTFILVAFKCAGKPTNILYGTHPGVGNGALNNYTFCNYCSKPKSPRTHHCRTCGMCVLDMDHHCPFIGNCVGAGNHKYFIAFLISAVISTSYAAVMCVYTLIHILPPIEKGAAYASDVAHVAHGNSISILRVVKNICLTYIANAVFISVRSLVLVYLFVASVSVAIGLSVLLWQQLSYIYEGKTYLSHLSSQGTEEDGEKSCRNLLTFFGCPHSIERHLPTIRNLRKRHKT) reveals several functional regions . The protein contains multiple cysteine-rich domains that are typical of S-acyltransferases and are likely involved in zinc coordination and substrate binding. The transmembrane topology suggests it is an integral membrane protein, consistent with its role in protein S-acylation at membrane interfaces.
At3g18620 facilitates the transfer of acyl groups (predominantly palmitate) to cysteine residues of target proteins through a thioester bond formation. The catalytic mechanism involves the DHHC domain, which forms an acyl-enzyme intermediate before transferring the acyl group to the substrate protein . The enzyme likely exhibits substrate specificity determined by both protein-protein interactions and the accessibility of target cysteines. Based on research with related S-acyltransferases, the reaction proceeds via a two-step ping-pong mechanism where the enzyme first auto-acylates using acyl-CoA as a donor before transferring the acyl group to the protein substrate . In cellular context, At3g18620 likely recognizes specific structural motifs or sequences in target proteins, though the exact determinants of substrate specificity remain to be fully characterized. Studies with related ZDHHC proteins suggest that substrate recognition involves both the DHHC domain and adjacent regions that contribute to protein-protein interactions.
For in vitro studies of At3g18620 activity, recombinant protein expression systems using E. coli or insect cells have proven effective for related S-acyltransferases. When working with At3g18620, researchers should consider using a coupled enzyme assay that measures CoA release during the acylation reaction, similar to the established real-time enzyme-coupled assay used for ZDHHC20 . For cellular studies, Arabidopsis cell cultures or heterologous expression in mammalian cells (HEK293T) provide suitable platforms to study enzyme function in a membrane environment. To track S-acylation activity, metabolic labeling with alkyne-tagged lipid probes (such as 18-Bz used for ZDHHC20) followed by click chemistry enables visualization of acylated proteins . For substrate identification, proximity labeling techniques combined with mass spectrometry offer powerful approaches to catalog the enzymatic targets in their native cellular environment. When designing activity assays, it's essential to include appropriate controls such as catalytically inactive mutants (e.g., mutations in the DHHC domain) to distinguish enzyme-specific acylation from background activity.
Recombinant expression of At3g18620 presents challenges due to its multiple transmembrane domains, requiring careful optimization to maintain protein folding and function. For prokaryotic expression, using E. coli strains optimized for membrane proteins (such as C41(DE3) or C43(DE3)) with controlled induction temperatures (typically 16-20°C) can improve yields of functional protein. Alternatively, eukaryotic expression systems such as insect cells (Sf9 or Hi5) or yeast (Pichia pastoris) often provide better folding environments for plant membrane proteins. The purification protocol should include detergent screening to identify optimal solubilization conditions that maintain the native protein conformation. Commonly, a combination of immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography yields the highest purity. For maintaining enzyme activity, it's crucial to include reducing agents (such as DTT or TCEP) in all buffers to protect the cysteine-rich DHHC domain. Based on commercial preparations, the recombinant protein is typically stored in Tris-based buffer with 50% glycerol at -20°C to maintain stability . For extended storage, aliquoting and storing at -80°C is recommended to prevent freeze-thaw cycles that can compromise enzyme activity.
Developing reliable assays for At3g18620 requires consideration of both the auto-acylation step and the substrate acylation step. For a comprehensive analysis, researchers should implement both biochemical and cellular approaches. In biochemical assays, the enzyme-coupled assay measuring CoA release during the acylation reaction provides real-time kinetic data . This can be supplemented with direct detection of protein acylation using radiolabeled palmitoyl-CoA or alkyne-tagged lipid analogs that permit subsequent detection via click chemistry and fluorescent labeling. For cellular assays, metabolic labeling with probes such as 17-octadecynoic acid (17-ODYA) followed by click chemistry enables visualization of acylated proteins in complex mixtures. Mass spectrometry-based approaches, particularly acyl-biotin exchange (ABE) or acyl-resin-assisted capture (Acyl-RAC), provide powerful tools for identifying specific S-acylation sites. When analyzing At3g18620 activity, it's essential to include appropriate controls: (1) catalytically inactive mutants (C156S mutation by analogy with ZDHHC20) , (2) treatment with hydroxylamine which cleaves thioester bonds, and (3) competition experiments with non-tagged palmitoyl-CoA to confirm specificity of labeling.
Characterizing substrate specificity of At3g18620 requires multi-faceted approaches combining computational prediction, in vitro validation, and in vivo confirmation. Initially, bioinformatic analysis using algorithms trained on known S-acylation sites can predict potential substrates based on sequence motifs surrounding cysteine residues. For direct identification of substrates, chemical genetic approaches similar to those developed for ZDHHC20 can be adapted for At3g18620 . This involves engineering an At3g18620 mutant (analogous to ZDHHC20[Y181G]) that can selectively utilize bumped lipid probes (such as 18-Bz) to label specific substrates . Subsequent proteomic analysis using quantitative mass spectrometry techniques (SILAC, TMT, or label-free quantification) can identify proteins specifically modified by the engineered enzyme-probe pair. To validate candidate substrates, site-directed mutagenesis of predicted acylation sites followed by functional assays confirms the biological relevance of the modification. Comparative analysis of substrates across different plant S-acyltransferases, examined through hierarchical clustering of substrate profiles, can reveal enzyme-specific preferences and functional redundancy. For the most comprehensive characterization, these approaches should be complemented with structural studies to understand the molecular basis of substrate recognition.
The specific role of At3g18620 in plant development remains to be fully characterized, but insights can be drawn from studies of protein S-acylation in plant biology. S-acylation regulates multiple aspects of plant development by modulating protein localization, stability, and signaling functions. In Arabidopsis, S-acylated proteins are involved in hormone signaling pathways, including abscisic acid (ABA) responses which regulate seed dormancy and germination . The involvement of S-acylation in ABA signaling suggests potential roles for At3g18620 in stress adaptation, particularly drought and osmotic stress responses. Research utilizing knockout or knockdown lines of at3g18620 would be valuable for assessing developmental phenotypes, especially under stress conditions. Transcriptomic analyses across different tissues and developmental stages can reveal expression patterns that suggest specific developmental functions. For stress response studies, exposing at3g18620 mutant plants to various abiotic stressors (drought, salt, temperature extremes) and assessing physiological responses (stomatal conductance, ABA sensitivity, ROS production) would illuminate its functional significance. Additionally, identifying At3g18620-specific substrates involved in stress signaling pathways could provide mechanistic insights into its role in plant adaptation to environmental challenges.
Chemical genetics approaches offer powerful tools for studying At3g18620 function by combining genetic engineering with selective chemical probes. Based on successful ZDHHC20 studies, researchers can develop an engineered At3g18620 mutant with a modified binding pocket (analogous to ZDHHC20[Y181G]) that accepts bumped lipid probes while retaining catalytic activity . The optimal approach involves first conducting structure-guided mutagenesis focusing on residues that line the acyl-CoA binding pocket but are distal to the catalytic site to preserve enzymatic function. Candidate mutations can be screened using molecular docking simulations before experimental validation. For probe design, researchers should synthesize a series of alkyne-tagged fatty acids with various "bumps" (such as acetyl, cyclopropyl, or benzyl groups) at different positions along the acyl chain . The mutant-probe pair should be validated by demonstrating: (1) selective labeling by the engineered enzyme compared to wild-type, (2) conservation of substrate specificity, and (3) efficient activation of the probe to CoA-thioester in cells. Once established, this system enables proteome-wide identification of direct At3g18620 substrates through click chemistry-based enrichment followed by mass spectrometry. The chemical genetic system could be further refined by developing orthogonal pairs for multiple Arabidopsis S-acyltransferases, enabling comparative substrate mapping and functional analysis across the enzyme family .
Analyzing substrate identification data requires robust statistical frameworks that account for the complexities of enrichment-based proteomics. For experiments using chemical genetic approaches with bumped probe pairs, differential enrichment analysis comparing samples expressing mutant At3g18620 versus wild-type controls should be performed using statistical methods designed for proteomics data. Recommended approaches include linear models with empirical Bayes statistics (limma), significance analysis of microarrays (SAM), or Bayesian approaches that handle the heteroscedasticity typical of mass spectrometry data. Researchers should implement appropriate normalization methods (global median, LOESS, or variance stabilizing normalization) to account for technical variability. For defining significant hits, a combination of fold-change thresholds (typically >2-fold enrichment) and multiple-testing corrected p-values (FDR < 0.05) provides a balance between sensitivity and specificity. To enhance confidence in substrate identification, orthogonal validation using targeted approaches such as site-directed mutagenesis of putative acylation sites is essential. For comparing substrate preferences across different S-acyltransferases, hierarchical clustering or principal component analysis can reveal patterns of substrate specificity. Additionally, enrichment analysis of identified substrates for Gene Ontology terms, protein domains, or subcellular localization can provide insights into the biological functions regulated by At3g18620-mediated S-acylation.
Discrepancies between in vitro and in vivo S-acylation data for At3g18620 are common and reflect the complexity of cellular contexts versus simplified biochemical systems. Such discrepancies should be analyzed systematically to extract biologically meaningful insights. In vitro systems may demonstrate broader substrate specificity due to the absence of spatial organization and regulatory factors present in cells. Conversely, in vivo systems capture the native cellular environment but may be influenced by indirect effects and compensatory mechanisms from other S-acyltransferases. When interpreting contradictory results, researchers should consider several factors: (1) substrate accessibility - proteins that co-localize with At3g18620 in vivo are more likely authentic substrates despite negative in vitro results, (2) cofactors or accessory proteins present in cells but absent in vitro may be required for specific substrate recognition, (3) competition with other S-acyltransferases in vivo may mask At3g18620-specific acylation, and (4) the lipid environment affects enzyme activity differently between reconstituted systems and cellular membranes. To reconcile discrepancies, complementary approaches such as proximity labeling techniques (BioID or APEX) can identify proteins that physically interact with At3g18620 in cells, providing additional evidence for direct substrates. Ultimately, functional validation through mutagenesis of acylation sites and assessment of phenotypic consequences provides the strongest evidence for biologically relevant At3g18620 substrates.
Several bioinformatic tools have been developed specifically for predicting S-acylation sites in proteins, which can be valuable for identifying potential At3g18620 substrates. CSS-Palm, NBA-Palm, and GPS-Lipid represent machine learning-based algorithms that identify potential S-acylation sites based on sequence patterns surrounding cysteine residues. These tools utilize training datasets from experimentally verified S-acylation sites and consider features such as amino acid composition, hydrophobicity, and secondary structure propensity. For Arabidopsis-specific predictions, researchers should prioritize tools trained on plant datasets or customize prediction parameters based on known plant S-acylation sites. Beyond sequence-based prediction, structural features such as proximity to transmembrane domains or membrane-associated regions provide additional evidence for potential acylation sites. For comprehensive analysis, researchers should integrate predictions with protein-protein interaction networks to identify proteins that physically interact with At3g18620. When applying these tools, it's essential to establish appropriate score thresholds based on sensitivity-specificity trade-offs, typically determined through receiver operating characteristic (ROC) curve analysis. Predictions should be filtered based on biological context, prioritizing proteins that co-localize with At3g18620 or function in related biological processes. Finally, comparative analysis across different plant species can identify evolutionarily conserved S-acylation sites, which often represent functionally important modifications.
Non-specific background is a common challenge in S-acylation studies that can obscure true At3g18620 substrates. To minimize background in metabolic labeling experiments, researchers should implement multiple control conditions and optimization strategies. For chemical genetic approaches using bumped probe pairs, the most critical control is comparing labeling between the engineered At3g18620 mutant and wild-type enzyme under identical conditions . Additionally, including a catalytically inactive mutant (e.g., C156S by analogy with ZDHHC20) controls for non-enzymatic probe reactivity . Optimizing probe concentration is essential, as concentrations above 20 μM can lead to increased non-specific labeling; titration experiments typically reveal optimal concentrations between 10-15 μM that balance specific signal with background . Serum concentration in cell culture media affects lipid metabolism and probe incorporation; reduced serum levels (0.5-2%) often improve signal-to-noise ratios without compromising cell viability . For click chemistry detection, carefully optimized reaction conditions (copper concentration, reducing agent, capture reagent quality) minimize non-specific reactions. Competition experiments with non-tagged palmitate can distinguish specific from non-specific labeling. In mass spectrometry-based approaches, implementing stable isotope labeling (SILAC or TMT) enables quantitative comparison between experimental and control conditions, facilitating statistical filtering of non-specific hits. Finally, hydroxylamine sensitivity serves as a critical control, as S-acylation is specifically cleaved by this treatment while other lipid modifications remain intact .
Expressing active At3g18620 in heterologous systems presents several technical challenges due to its multiple transmembrane domains and requirement for proper membrane integration. To overcome these challenges, researchers should consider a multi-faceted optimization approach. For prokaryotic expression, using specialized E. coli strains (C41(DE3), C43(DE3), or Lemo21(DE3)) designed for membrane protein expression can significantly improve yields. Codon optimization for the expression host and fusion with solubility-enhancing tags (MBP, SUMO, or Trx) can increase protein production. Expression temperature and inducer concentration require careful optimization, with lower temperatures (16-20°C) and reduced inducer concentrations often favoring proper folding over quantity. For eukaryotic expression, insect cells or mammalian cells provide more suitable environments for plant membrane proteins. Co-expression with molecular chaperones can improve folding efficiency. If full-length expression remains challenging, functional domain expression (such as the catalytic DHHC domain with minimal transmembrane regions) may provide an alternative approach for activity studies. For activity assessment, comparing auto-acylation capacity with established S-acyltransferases like ZDHHC20 provides a benchmark for proper folding . In plant expression systems, transient expression in Nicotiana benthamiana followed by microsome isolation offers a native-like membrane environment while avoiding the time constraints of stable Arabidopsis transformation. Finally, cell-free expression systems supplemented with appropriate lipids and detergents represent emerging alternatives for difficult membrane proteins.
Distinguishing the specific activity of At3g18620 from other Arabidopsis S-acyltransferases requires combinatorial approaches targeting enzyme-specific features. Genetic approaches utilizing CRISPR-Cas9 knockout or RNAi knockdown of At3g18620, followed by global profiling of protein S-acylation using methods like acyl-biotin exchange (ABE) or acyl-RAC, can identify proteins whose acylation is specifically reduced. For more direct evidence, chemical genetic strategies employing engineered At3g18620 mutants that accept orthogonal lipid probes provide powerful tools for enzyme-specific substrate identification . Complementary in vitro assays with purified recombinant At3g18620 and candidate substrates establish direct enzymatic relationships. Comparative substrate profiling across multiple Arabidopsis S-acyltransferases can reveal unique substrates versus those modified by multiple enzymes. For investigating enzyme-substrate selectivity mechanisms, chimeric constructs swapping domains between different S-acyltransferases help identify regions governing substrate recognition. Cellular co-localization studies using fluorescently tagged At3g18620 and substrates provide additional evidence for specific enzyme-substrate relationships, as S-acylation typically requires spatial proximity. Temporal regulation can also distinguish enzyme specificity, as different S-acyltransferases may be active under specific developmental or stress conditions. Implementation of proximity-dependent labeling methods (BioID or APEX) fused to At3g18620 enables identification of proteins that physically interact with the enzyme, providing complementary evidence for direct substrates versus those modified by other S-acyltransferases.