Recombinant Arabidopsis thaliana Probable S-acyltransferase At3g48760 (At3g48760)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

PropertyDetails
UniProt IDQ9M306
Gene NamePAT5 (Protein S-Acyltransferase 5)
Protein LengthPartial sequence (1-476 aa)
Expression SystemMammalian cells
Purification>85% purity (SDS-PAGE) ; Tris/PBS-based buffer with 50% glycerol for storage
Key DomainsDHHC-type zinc finger domain, critical for catalytic activity

This recombinant protein belongs to the DHHC-CRD (Cysteine-Rich Domain) family, which catalyzes the transfer of palmitate or other fatty acids to cysteine residues of target proteins .

Immune Response Regulation

At3g48760 (PAT5) mediates S-acylation of the purinergic receptor P2K1, which is essential for extracellular ATP (eATP)-induced immune signaling. Key findings include:

  • Upregulation of PAT5 expression upon eATP treatment or pathogen (Pseudomonas syringae) infection .

  • PAT5-dependent S-acylation stabilizes P2K1 at the plasma membrane, enhancing its autophosphorylation and downstream defense responses .

Subcellular Localization and Substrates

LocalizationSubstratesBiological Processes
Plasma membrane P2K1 receptor Immune signaling, pathogen response

Research Applications

  • Immune Signaling Studies: Used to investigate S-acylation mechanisms in plant-pathogen interactions .

  • Protein-Protein Interaction Assays: Employed in ELISAs and pull-down experiments to identify binding partners .

  • Enzyme Kinetics: Characterizes substrate specificity and catalytic efficiency of PAT enzymes .

Key Research Findings

  1. PAT5 Redundancy: PAT5 belongs to a clade with PAT6, PAT7, PAT8, and PAT9, showing functional redundancy in immune responses .

  2. Evolutionary Conservation: The DHHC domain of At3g48760 shares homology with yeast Akr1 and Arabidopsis TIP1 palmitoyltransferases .

  3. Pathogen Response: Knockdown of PAT5 impairs P2K1-mediated resistance to Pseudomonas syringae .

Challenges and Future Directions

  • Structural Resolution: Full-length 3D structure determination remains pending.

  • Substrate Screening: Broader profiling of PAT5 targets in stress and developmental contexts is needed .

Product Specs

Form
Lyophilized powder
Note: We strive to ship the format currently in stock. If you have a specific format preference, please include this detail in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a reference point for your consideration.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms maintain stability for 6 months at -20°C/-80°C. Lyophilized forms exhibit a longer shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We prioritize the production of tags as specified by the customer. Please inform us of your desired tag type, and we will strive to meet your requirements.
Synonyms
PAT05; At3g48760; T21J18.30; Probable protein S-acyltransferase 5; Probable palmitoyltransferase At3g48760; Zinc finger DHHC domain-containing protein At3g48760
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-476
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PAT05
Target Protein Sequence
MLDLQPSDRRHGAPSSSGGVSGGDELIRTYKGWKGNNVFFLGGRLVFGPDARSILITVFL ITAPVIVFCIFVGRKFIDDFPHHRGVSVLAVAVGLILLDLVFLLLTSARDPGIIPRNLYP PEPESNEGNGEPRLAHTPQSRLPRTKDMIVNGITVKIKYCDTCMLYRPPRASHCSICNNC VEKFDHHCPWLGQCIGLRNYRFYFMFVLCSTLLCIYVHVFCWIYVKRIMDSENINIWKSF LKTPASIALIIYTFICVWFVGGLTCFHLYLMSTNQSTYENFRYRYDRHENPFNKGIVGNF MEVFCTNVAVSQNSFREKVSKEPAIPPRTVNGGMSSPSLQKVSNDIEMGRKPVWHETVEE ELGDIEKDMEAGVASRDLSRMLPPEESEGRGIMHSRESSRGRGIMHSRESSRGRRGGSWE LSSRVNEDLRTRDESVSRVGEDSSESSDNDASRDLHVEIYDAVTSRGRTGTGIGRL
Uniprot No.

Target Background

Function
Palmitoyl acyltransferase.
Database Links

KEGG: ath:AT3G48760

STRING: 3702.AT3G48760.1

UniGene: At.43205

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is At3g48760 and what are its alternative designations?

At3g48760 is a putative S-acyltransferase gene in Arabidopsis thaliana. It is also known as PAT05 (Protein S-acyltransferase 5), probable palmitoyltransferase At3g48760, and Zinc finger DHHC domain-containing protein At3g48760 . This protein belongs to the DHHC-CRD (Asp-His-His-Cys cysteine-rich domain) family of proteins that function as protein S-acyl transferases (PATs) .

What is the functional role of S-acyltransferases in plants?

S-acyltransferases catalyze S-acylation (also known as palmitoylation), which is an important secondary and reversible post-translational modification that regulates membrane association, trafficking, and function of target proteins . This enzymatic reaction is mediated by protein S-acyl transferases (PATs). In plants, S-acylation affects various cellular processes including signal transduction, protein localization, and immune responses .

How is recombinant At3g48760 typically prepared for research?

Recombinant At3g48760 protein is typically expressed in E. coli expression systems. The protein is generally supplied in liquid form containing glycerol as a stabilizing agent . For optimal storage, it should be kept at -20°C, with extended storage recommended at -20°C or -80°C. Repeated freezing and thawing is not recommended, and working aliquots should be stored at 4°C for no more than one week .

What is the expression pattern of At3g48760 in Arabidopsis tissues?

At3g48760 displays a relatively weak expression pattern in flowers, roots, and young siliques . It belongs to Group 4 of the PAT family classification based on expression patterns, which includes members that do not show strong tissue preference at the transcription level . This suggests that At3g48760 might have a more general role across different tissues rather than a tissue-specific function.

What are the challenges in studying At3g48760 function through knockout mutants?

Studying At3g48760 through knockout mutants may present challenges due to potential functional redundancy among the 24 PAT family members in Arabidopsis . Since multiple PATs might have overlapping functions, single gene knockouts might not display obvious phenotypes. Additionally, the relatively weak and non-tissue-specific expression pattern of At3g48760 could make phenotypic characterization more difficult . Researchers might need to consider generating multiple gene knockouts or using more sensitive phenotyping approaches.

How might At3g48760 participate in plant immune responses?

While the specific role of At3g48760 in immunity is not directly mentioned in the search results, research on related S-acyltransferases provides insight into potential functions. S-acylation affects the temporal dynamics of receptor activity through mechanisms like autophosphorylation and protein degradation, as demonstrated with the P2K1 receptor involved in extracellular ATP-induced immune responses . Similar mechanisms might apply to immune-related proteins that could be substrates of At3g48760, potentially affecting plant defense responses through regulation of receptor proteins.

What methods can be used to identify substrates of At3g48760?

Identification of At3g48760 substrates would likely require a combination of approaches:

  • Proximity-based labeling techniques (such as BioID or APEX)

  • Protein-protein interaction assays (yeast two-hybrid, co-immunoprecipitation)

  • Comparative proteomics between wild-type and knockout/knockdown plants

  • Acyl-biotin exchange (ABE) or acyl-resin-assisted capture (acyl-RAC) methods to identify S-acylated proteins that might be differentially modified in At3g48760 mutants

What controls should be included when studying At3g48760 expression via real-time PCR?

When studying At3g48760 expression via real-time PCR, researchers should include:

  • Reference gene controls: ACT2 (Actin 2) is commonly used to normalize for differences in total RNA amount, as demonstrated in expression studies of Arabidopsis PATs .

  • Negative controls: No-template controls and RT-minus controls to detect contamination or genomic DNA amplification.

  • Positive controls: Tissues known to express At3g48760, such as flowers and young siliques .

  • Technical replicates: All standard and experimental samples should be assayed in triplicate wells as done in previous studies .

  • Primer specificity controls: Ensure primers are specific to At3g48760 and do not amplify related PAT genes.

The thermal profile should consist of 1 cycle at 95°C for 1 min followed by 40 cycles at 95°C for 0.05 s and at 60°C for 30 s, similar to protocols used in previous studies .

How can researchers determine the subcellular localization of At3g48760?

To determine the subcellular localization of At3g48760, researchers can use:

  • Fluorescent protein fusion constructs (GFP, YFP, or mCherry fused to At3g48760) for live-cell imaging

  • Co-localization studies with known organelle markers

  • Immunolocalization with specific antibodies against At3g48760

  • Subcellular fractionation followed by western blotting

Based on studies of other Arabidopsis PAT proteins, At3g48760 might localize to the plasma membrane, which is where most plant PAT activity is concentrated, or potentially to other membrane compartments like the endoplasmic reticulum, Golgi, endosomal compartments, or the vacuolar membrane .

What approaches can be used to verify the S-acyltransferase activity of At3g48760?

To verify the S-acyltransferase activity of At3g48760, researchers can employ:

  • In vitro S-acyltransferase assays using purified recombinant At3g48760 and putative substrate proteins

  • Complementation studies in yeast PAT mutants (e.g., akr1Δ), similar to approaches used for TIP1/AtPAT24

  • Site-directed mutagenesis of the conserved DHHC domain to demonstrate loss of function

  • Metabolic labeling with radioactive palmitate or clickable palmitate analogs to track S-acylation in vivo

  • Comparison of the S-acylation status of putative target proteins in wild-type versus At3g48760 knockout/knockdown plants

How should expression data for At3g48760 be normalized and analyzed?

Expression data for At3g48760 should be normalized and analyzed following these guidelines:

  • Use appropriate reference genes like ACT2 for normalization of qRT-PCR data .

  • Calculate relative abundance by interpolating Ct values to standard curves.

  • Present data as the ratio of At3g48760 transcript abundance to ACT2 transcript abundance.

  • Include statistical analysis (e.g., means ± standard deviation) from at least three biological replicates.

  • When comparing to microarray data, be aware that discrepancies might exist, as observed in previous studies where real-time PCR results sometimes differed from microarray data for some PAT genes .

  • For hierarchical clustering of expression patterns, consider using rescaled distance measurements as shown in previous PAT family studies .

What criteria should be used to classify At3g48760 substrate specificity?

To classify At3g48760 substrate specificity, researchers should consider:

  • Sequence motifs surrounding cysteine residues in target proteins

  • Structural features that might facilitate enzyme-substrate interaction

  • Competition assays with other known PAT substrates

  • Kinetic parameters (Km, Vmax) for different substrates

  • In vivo validation of putative substrates in plant systems

  • Comparison with substrates of closely related PAT family members

How does At3g48760 compare to other members of the Arabidopsis PAT family?

At3g48760 belongs to Group 4 of the PAT family based on expression pattern classification, along with At5g41060, At1g69420, At5g04270, and At4g22750 . Unlike some PAT genes that show tissue-specific expression (like Group 1 members that are highly expressed in flowers), At3g48760 and other Group 4 members do not show strong tissue preference at the transcription level . At3g48760 displays relatively weaker expression in flowers, roots, and young siliques compared to some other family members .

The table below summarizes the classification of Arabidopsis PAT genes based on expression patterns:

GroupMembersExpression Characteristics
Group 1At3g56920, At5g05070, At3g26935, At3g51390, At3g18620, At5g20350Relatively high expression in flowers
Group 2At4g24630, At3g56930Preferentially expressed in old siliques
Group 3At3g04970, At2g14255, At3g09320, At3g60800, At4g00840High expression in seedlings and young siliques
Group 4At5g41060, At1g69420, At5g04270, At4g22750, At3g48760No strong tissue preference
Group 5At2g40990Expression not detected in normal conditions

What are the potential applications of studying At3g48760 in plant stress responses?

Studying At3g48760 in plant stress responses could lead to:

  • Understanding how S-acylation regulates stress signaling components

  • Identifying specific stress response pathways that depend on proper protein S-acylation

  • Developing strategies to enhance plant stress tolerance through modulation of S-acylation

  • Comparative studies with stress-responsive PAT genes like At2g40990, which shows dramatic expression changes under stress conditions

  • Investigation of S-acylation-dependent immune responses, similar to the role of S-acylation in regulating the P2K1 receptor involved in ATP-induced immune responses

What new technologies might advance research on At3g48760 function?

Emerging technologies that could advance research on At3g48760 function include:

  • CRISPR/Cas9 genome editing for creating precise mutations in At3g48760 or its potential substrates

  • Proximity labeling techniques (BioID, TurboID, APEX) for identifying proteins in the vicinity of At3g48760

  • Advanced mass spectrometry methods for detecting and quantifying S-acylation sites

  • Single-cell transcriptomics to detect cell-specific expression patterns that might be masked in whole-tissue analyses

  • Live-cell imaging with improved spatiotemporal resolution to track dynamics of S-acylated proteins

  • Cryo-electron microscopy for structural determination of At3g48760 alone or in complex with substrates

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.