Recombinant Arabidopsis thaliana Probable S-acyltransferase At3g56930 (At3g56930)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Probable S-acyltransferase At3g56930

Recombinant Arabidopsis thaliana Probable S-acyltransferase At3g56930 (At3g56930) is a DHHC-type zinc finger domain-containing protein involved in protein S-acylation, a reversible lipid post-translational modification critical for membrane association, trafficking, and signaling in eukaryotes . This enzyme belongs to the protein S-acyltransferase (PAT) family, catalyzing the attachment of fatty acids (typically palmitate) to cysteine residues via thioester bonds . Recombinant production enables biochemical and structural studies of this enzyme, which is implicated in plant development and stress responses .

Gene and Protein Features

PropertyDetails
Gene NameAT3G56930
Protein NameProbable S-acyltransferase At3g56930
UniProt IDQ9M1K5
Gene TypeProtein-coding
OrganismArabidopsis thaliana (Mouse-ear cress)
Protein Length477 amino acids
Domain ArchitectureDHHC zinc finger domain, transmembrane regions
Post-Translational FeaturesPredicted transmembrane helices and cytoplasmic catalytic domain

The recombinant form is expressed with a Tris-based buffer stabilizer and retains functional motifs required for acyltransferase activity .

Functional Role in S-Acylation

S-acylation dynamically regulates:

  • Membrane Targeting: Facilitates transient anchoring of proteins to membranes (e.g., ROP GTPases, CBL calcium sensors) .

  • Signal Transduction: Modulates receptor-like kinases (RLKs) and G-proteins in stress responses .

  • Protein Stability: Protects substrates from degradation by enhancing hydrophobic interactions .

At3g56930 specifically catalyzes dual lipidation (e.g., prenylation + S-acylation) in substrates like ROP GTPases, enabling precise subcellular localization .

Expression Systems

  • Arabidopsis-Based Platforms: Native host systems preserve post-translational modifications and complex assembly .

  • Escherichia coli: Cost-effective bulk production but lacks eukaryotic processing .

Research Findings

  • Genetic Studies: T-DNA insertion mutants of At3g56930 show altered root hair development, linking it to cell polarity .

  • Proteomics: Identified substrates include calcium sensors (CBLs), receptor kinases, and vesicle trafficking proteins .

  • Enzymatic Activity: Shows auto-acylation capacity, a hallmark of PATs, confirmed via in vitro assays .

Challenges and Future Directions

  • Heterologous Expression: Low solubility in bacterial systems necessitates optimization (e.g., codon usage, chaperone co-expression) .

  • Substrate Specificity: High redundancy among 24 Arabidopsis PATs complicates functional studies .

  • Therapeutic Potential: Structural insights from recombinant At3g56930 could inform drug design targeting human ZDHHC homologs .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for the specific delivery timeline.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PAT04; At3g56930; F24I3.10; Probable protein S-acyltransferase 4; Probable palmitoyltransferase At3g56930; Zinc finger DHHC domain-containing protein At3g56930
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-477
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PAT04
Target Protein Sequence
MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSTILILGPAVMFFVKMYTKMAD PRTKNPNLCIPILCVSWILTILDIFFLLMTSSRDPGIVPRSFRPPETDDAPDSTTPSMEW VSGRTPNIRIPRVKDVTVNGHTVKVKFCDTCLLYRPPRASHCSICNNCVQRFDHHCPWVG QCIGVRNYRFFFMFISTSTTLCIYVFAFSWLNIFQRHMDEKISIWKAISKDVLSDILIVY CFITVWFVGGLTIFHSYLICTNQTTYENFRYRYDKKENPYNKGILGNIWEIFLSKIPPSM NKFRSFVKEEDYMMMMVETPTSNLGESLVSSKEKIDIEMGGGRIVDESGKSYSLPEILRN LNYEDLEDDCEEDDLKAKDHHHHHHHQHQHNEGIIPPFDPFFTNEIGSNKDERNGEESGG SSSDGENTGKRVRVSDEDEEKVEGYERNWSTDKGMNINAGSEDGASSPVSTSPMLRK
Uniprot No.

Target Background

Function
Palmitoyl acyltransferase.
Database Links

KEGG: ath:AT3G56930

STRING: 3702.AT3G56930.1

UniGene: At.34882

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of At3g56930?

At3g56930 is a probable S-acyltransferase (EC 2.3.1.-) from Arabidopsis thaliana with alternative names including probable palmitoyltransferase and zinc finger DHHC domain-containing protein. The protein contains 477 amino acids with a distinctive DHHC domain characteristic of S-acyltransferases. This enzyme likely catalyzes the transfer of fatty acid groups (primarily palmitate) to cysteine residues in target proteins, a post-translational modification that can regulate protein localization, stability, and function .

The amino acid sequence reveals several key structural features:

  • N-terminal region with transmembrane domains

  • The catalytic DHHC domain (Asp-His-His-Cys zinc finger domain)

  • C-terminal cytoplasmic tail with regulatory functions

What are the optimal storage conditions for Recombinant At3g56930?

The recombinant At3g56930 protein should be stored in Tris-based buffer containing 50% glycerol at -20°C for regular use. For extended storage, maintaining the protein at -20°C or -80°C is recommended. To preserve protein activity, repeated freeze-thaw cycles should be avoided. Working aliquots can be stored at 4°C for up to one week without significant loss of activity .

How does At3g56930 compare to other S-acyltransferases in plants?

At3g56930 belongs to the DHHC-CRD family of S-acyltransferases found across plant species. While specific comparative data for At3g56930 is limited in the provided search results, plant DHHC proteins typically share conserved domains with variable N- and C-terminal regions that contribute to substrate specificity.

FeatureAt3g56930Typical Plant DHHC Proteins
Catalytic domainDHHC-CRDDHHC-CRD
LocalizationMembrane-associatedMembrane-associated
Expression region1-477Variable
UniProt IDQ9M1K5Various
Gene nameF24I3.10Various

What are the recommended approaches for assessing At3g56930 enzymatic activity in vitro?

When designing experiments to assess At3g56930 S-acyltransferase activity, researchers should consider a multi-method approach:

  • Metabolic labeling assay: Incubate purified At3g56930 with radiolabeled palmitoyl-CoA (typically [³H]-palmitoyl-CoA) and candidate substrate proteins. After reaction completion, analyze incorporation using SDS-PAGE followed by fluorography.

  • Click chemistry-based detection: Use alkyne-modified fatty acid analogs (e.g., 17-octadecynoic acid) as substrates, followed by copper-catalyzed azide-alkyne cycloaddition with fluorescent or biotin-labeled azides for visualization or purification.

  • Acyl-biotin exchange (ABE): This three-step protocol involves:

    • Blocking free thiols with N-ethylmaleimide

    • Cleaving thioester bonds with hydroxylamine

    • Labeling newly exposed thiols with biotin-HPDP

A standardized reaction buffer containing 50 mM HEPES (pH 7.4), 2 mM MgCl₂, 1 mM DTT, and 0.1% Triton X-100 is commonly used, with reactions performed at 30°C for 30-60 minutes.

What techniques are most effective for studying At3g56930 substrate specificity?

Determining substrate specificity of At3g56930 requires systematic approaches:

  • Proteomics-based identification:

    • Perform comparative analysis of palmitoylated proteins in wild-type versus At3g56930 knockout or overexpression lines

    • Use stable isotope labeling with amino acids in cell culture (SILAC) combined with ABE methods to quantitatively assess changes in protein palmitoylation

  • In vitro screening assays:

    • Test a panel of candidate proteins with purified At3g56930

    • Utilize peptide arrays containing potential palmitoylation motifs to identify sequence preferences

  • Mutagenesis studies:

    • Generate site-directed mutants of potential substrates by replacing candidate cysteine residues

    • Assess palmitoylation efficiency for each mutant to map critical residues

The data analysis should include statistical validation comparing palmitoylation efficiency across different substrates, with significance thresholds typically set at p < 0.05.

How can researchers effectively analyze the regulatory mechanisms governing At3g56930 expression and activity?

Analysis of At3g56930 regulatory mechanisms requires integration of multiple approaches:

  • Transcriptional regulation:

    • Perform promoter analysis using deletion constructs fused to reporter genes

    • Identify transcription factor binding sites using chromatin immunoprecipitation (ChIP) followed by sequencing

    • Validate with electrophoretic mobility shift assays (EMSA) or yeast one-hybrid screens

  • Post-translational modifications:

    • Map phosphorylation, ubiquitination, or other modifications using mass spectrometry

    • Generate phosphomimetic or phospho-dead variants to assess functional consequences

    • Analyze enzymatic activity under different cellular conditions (e.g., stress, hormone treatment)

  • Protein-protein interactions:

    • Perform co-immunoprecipitation followed by mass spectrometry to identify interaction partners

    • Validate interactions using yeast two-hybrid, bimolecular fluorescence complementation, or FRET analysis

    • Map interaction domains through deletion constructs

Data integration should involve network analysis software to visualize regulatory connections, with statistical validation through multiple biological replicates (n ≥ 3) and appropriate controls.

What methodologies are recommended for investigating the role of At3g56930 in plant stress responses?

Investigating At3g56930's role in stress responses requires a multi-tiered experimental design:

  • Genetic approaches:

    • Generate and characterize knockout/knockdown lines using T-DNA insertion, CRISPR-Cas9, or RNAi

    • Create overexpression lines with constitutive or inducible promoters

    • Develop complementation lines expressing wild-type or catalytically inactive variants

  • Stress exposure experiments:

    • Subject plant lines to abiotic stressors (drought, salt, temperature extremes)

    • Apply biotic stress through pathogen infection or elicitor treatment

    • Quantify stress tolerance parameters (survival rate, growth metrics, ROS production)

  • Molecular phenotyping:

    • Perform RNA-seq to identify differentially expressed genes

    • Use metabolomics to detect changes in stress-related metabolites

    • Analyze protein palmitoylation patterns under stress conditions using ABE combined with proteomics

Statistical analysis should employ ANOVA with post-hoc tests for multiple comparisons, with significance threshold at p < 0.05 and a minimum of three biological replicates per condition.

How can researchers address contradictory data regarding At3g56930 substrate specificity?

When faced with contradictory results regarding At3g56930 substrate specificity, a systematic troubleshooting approach is recommended:

  • Method validation:

    • Compare detection techniques (ABE, metabolic labeling, click chemistry)

    • Assess technical variables (protein preparation, buffer conditions, reaction time)

    • Include appropriate positive and negative controls in each experiment

  • Cross-validation strategies:

    • Combine in vitro and in vivo approaches

    • Use complementary techniques to verify key findings

    • Collaborate with other laboratories to independently reproduce results

  • Biological context considerations:

    • Examine whether contradictions are due to different experimental systems

    • Assess physiological relevance of reaction conditions

    • Consider developmental stage or tissue-specific factors

A recommended approach for resolving contradictions is to establish a standardized experimental pipeline that includes:

Experimental StepMethodological Considerations
Protein preparationPurification method, tag position, buffer composition
Activity assaySubstrate concentration, reaction time, pH, temperature
Detection methodSensitivity, specificity, quantification approach
Data analysisStatistical methods, normalization, outlier identification
ValidationIndependent techniques, biological replicates, controls

What are the critical factors to consider when designing expression systems for At3g56930?

Successful expression and purification of functional At3g56930 requires careful consideration of several factors:

  • Expression system selection:

    • Bacterial systems (E. coli): Simple but may lack post-translational modifications

    • Yeast systems (P. pastoris, S. cerevisiae): Better protein folding for complex proteins

    • Insect cell systems (Sf9, High Five): Suitable for membrane proteins

    • Plant expression systems (N. benthamiana): Most native-like environment

  • Vector design considerations:

    • Promoter strength and inducibility

    • Fusion tag selection (His, GST, MBP) and position (N- or C-terminal)

    • Inclusion of protease cleavage sites

    • Codon optimization for expression host

  • Solubilization and purification strategies:

    • Detergent selection (CHAPS, DDM, Triton X-100)

    • Lipid supplementation to maintain native conformation

    • Stepwise purification protocol optimization

For optimal At3g56930 expression, a recommended approach is insect cell expression with an N-terminal His-tag, induction at lower temperatures (18-22°C), and purification in the presence of glycerol to maintain stability.

What statistical approaches are most appropriate for analyzing At3g56930 functional data?

Analysis of At3g56930 functional data requires appropriate statistical methods depending on experimental design:

When reporting results, include:

  • Sample size (n) for each experimental group

  • Measures of central tendency (mean/median) with dispersion (SD/SEM)

  • Exact p-values and confidence intervals

  • Effect sizes for significant differences

How does At3g56930 research relate to the study of allosteric regulation in plant enzymes?

While At3g56930 itself has not been directly characterized for allosteric regulation in the provided search results, research on plant enzymes like aspartate kinase-homoserine dehydrogenase from Arabidopsis thaliana provides relevant insights into allosteric regulation mechanisms that may apply to At3g56930 .

Approaches for investigating potential allosteric regulation of At3g56930 include:

  • Structural analysis:

    • Identify potential allosteric binding sites using computational modeling

    • Compare with known allosterically regulated plant enzymes

    • Design mutations that may affect allosteric sites without disrupting catalytic function

  • Functional assays:

    • Screen potential effector molecules systematically

    • Measure enzymatic activity under varying concentrations of candidate effectors

    • Analyze kinetic parameters (Km, Vmax) to distinguish competitive from allosteric effects

  • In vivo validation:

    • Examine enzyme activity under physiological conditions where effector concentrations vary

    • Generate plant lines expressing At3g56930 variants with altered allosteric sites

    • Monitor physiological consequences of disrupted regulation

Based on studies of other Arabidopsis enzymes, potential allosteric effectors worth investigating include amino acids (leucine, alanine, cysteine, isoleucine, serine, valine) and pathway products .

What approaches should be used to investigate the role of At3g56930 in protein trafficking and membrane dynamics?

S-acyltransferases like At3g56930 likely play crucial roles in protein trafficking and membrane dynamics. To investigate these functions:

  • Subcellular localization studies:

    • Generate fluorescent protein fusions to determine At3g56930 localization

    • Perform co-localization studies with organelle markers

    • Use super-resolution microscopy to examine membrane microdomain association

  • Protein trafficking assays:

    • Track movement of known palmitoylated proteins in wild-type versus At3g56930 mutant backgrounds

    • Employ pulse-chase experiments with fluorescence recovery after photobleaching (FRAP)

    • Use synchronized expression systems with temperature-sensitive trafficking blocks

  • Membrane association analysis:

    • Perform membrane fractionation to quantify protein distribution

    • Use detergent resistance assays to assess lipid raft association

    • Employ fluorescence correlation spectroscopy to measure diffusion coefficients

  • Interactome analysis:

    • Identify interaction partners involved in vesicular trafficking

    • Map temporal dynamics of protein-protein interactions during trafficking events

    • Validate functional significance through mutational analysis

Data analysis should incorporate quantitative imaging measures with proper statistical validation, including Pearson's correlation coefficients for co-localization and statistical testing of differences in trafficking rates.

What emerging technologies hold the most promise for advancing At3g56930 research?

Several cutting-edge technologies offer significant potential for advancing At3g56930 research:

  • CRISPR-based technologies:

    • Base editors for precise modification of catalytic residues

    • Prime editing for introducing specific mutations

    • CRISPR activation/interference for modulating expression without genetic modification

    • CRISPR screens to identify genetic interactions

  • Advanced imaging techniques:

    • Live-cell super-resolution microscopy for tracking protein dynamics

    • Single-molecule tracking to monitor enzyme-substrate interactions

    • Correlative light and electron microscopy for structural context

    • Proximity labeling to map spatial proteomics

  • Computational approaches:

    • Molecular dynamics simulations to predict substrate binding

    • Machine learning algorithms to identify palmitoylation sites

    • Systems biology modeling of S-acyltransferase networks

    • AlphaFold2 or similar tools for structural prediction

  • Metabolic engineering applications:

    • Synthetic biology circuits incorporating At3g56930

    • Engineered variants with modified substrate specificity

    • In planta metabolic flux analysis to trace palmitoylation dynamics

Researchers should consider interdisciplinary collaborations to fully leverage these technologies, particularly combining computational modeling with experimental validation.

How can statistical methods improve the analysis of At3g56930 experimental data?

Advanced statistical approaches can significantly enhance the rigor of At3g56930 research:

  • Experimental design optimization:

    • Power analysis to determine appropriate sample sizes

    • Factorial designs to efficiently test multiple variables

    • Latin square or other balanced designs to control for confounding factors

  • Modern statistical methods:

    • Bayesian approaches for incorporating prior knowledge

    • Mixed effects models for handling nested data structures

    • Machine learning for pattern recognition in complex datasets

    • Meta-analysis techniques for integrating multiple studies

  • Visualization improvements:

    • Data visualization beyond simple bar charts (e.g., violin plots, bean plots)

    • Interactive visualizations for exploring multidimensional data

    • Standardized effect sizes to facilitate comparison across studies

When reporting statistical results, researchers should include:

Statistical ElementRecommended Reporting
Effect sizeCohen's d, odds ratio, or percent change
Uncertainty95% confidence intervals or credible intervals
Model validationCross-validation or bootstrapping results
Data availabilityRepository links for raw data and analysis code

These approaches align with best practices in statistical reporting for biological research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.