Recombinant Arabidopsis thaliana Probable S-acyltransferase At3g60800 (At3g60800)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
PAT14; At3g60800; T4C21_210; Probable protein S-acyltransferase 14; Probable palmitoyltransferase At3g60800; Zinc finger DHHC domain-containing protein At3g60800
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PAT14
Target Protein Sequence
MHRSGTTMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALSQGGLDSLAA LTILILFHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLNSLDFVGLQSDSS SSNPRVRFCRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTF LETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAG NTTTIEAYEKKTTTKWRYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPS KPDFDSQ
Uniprot No.

Target Background

Function
Palmitoyl acyltransferase.
Database Links

KEGG: ath:AT3G60800

STRING: 3702.AT3G60800.1

UniGene: At.27704

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is At3g60800 and what is its role in Arabidopsis thaliana?

At3g60800 is one of the 24 protein S-acyltransferase (PAT) genes identified in the Arabidopsis thaliana genome. This gene encodes an enzyme belonging to the DHHC-Cysteine-Rich Domain (DHHC-CRD) containing family of proteins that catalyzes S-acylation, a critical post-translational modification. S-acylation, also known as S-palmitoylation, is a reversible secondary modification that regulates membrane association, trafficking, and function of target proteins within the cell . The At3g60800 gene is located on chromosome 3, which notably contains 10 of the 24 PAT loci in the Arabidopsis genome, making it the chromosome with the highest concentration of PAT genes .

How does At3g60800 fit within the broader PAT family in Arabidopsis?

At3g60800 is part of the diverse PAT family in Arabidopsis thaliana that consists of 24 members. Phylogenetic analysis has revealed that most Arabidopsis PATs cluster into three main clades: group A (AtPATs 1-9), group B (AtPATs 11-16), and group C (AtPATs 18-22) . While the search results don't specifically mention which clade At3g60800 belongs to, its position on chromosome 3 places it among the highest concentration of PAT genes. The evolutionary relationships between these PATs are reflected in their sequence conservation rates, with the most homogeneous cluster being group A, which shows higher conservation rates compared to other groups .

What molecular weight and amino acid composition characterize the At3g60800 protein?

The molecular characteristics of At3g60800 can be inferred from patterns observed in other Arabidopsis PATs. PAT proteins in Arabidopsis typically range from approximately 30 kDa to over 70 kDa. Based on other PATs located on chromosome 3, we can estimate that At3g60800 likely falls within this range. For example, AtPAT20, another chromosome 3 PAT (At3g22180), has a predicted size of 77 kDa with 706 amino acids . The exact size and composition of At3g60800 would require consulting protein databases or experimental determination through methods such as SDS-PAGE analysis of the purified recombinant protein.

How does At3g60800 catalyze the S-acylation reaction?

The S-acylation reaction catalyzed by PATs like At3g60800 follows a mechanism centered on the DHHC motif. The enzymatic process involves the transfer of fatty acyl groups (commonly palmitate or stearate) to cysteine residues of target proteins via thioester bonds . The mechanism likely proceeds through an autoacylation intermediate where the PAT enzyme itself becomes temporarily S-acylated at the catalytic cysteine within the DHHC motif before transferring the acyl group to the substrate protein. Studies on plant substrates like ROP6 and CBL proteins have demonstrated that Arabidopsis PATs can transfer different acyl groups including both palmitate and stearate, suggesting potential substrate or acyl-CoA specificity that may vary among different PAT family members .

What potential phenotypes might be associated with At3g60800 dysfunction?

Disruption of PAT function in Arabidopsis has been linked to various developmental phenotypes. The best-characterized example is TIP GROWTH DEFECTIVE1 (TIP1/AtPAT24), where mutations lead to defects in root hair formation and growth . By analogy, disruption of At3g60800 function might affect developmental processes or cellular functions dependent on proper protein S-acylation. Potential phenotypes could involve alterations in cell growth, membrane dynamics, signaling pathways, or protein trafficking. The exact phenotype would depend on the specific substrates of At3g60800 and the cellular contexts in which they function. T-DNA insertion lines or CRISPR-generated knockout mutants would be valuable tools for investigating the physiological roles of At3g60800.

What expression systems are suitable for producing recombinant At3g60800?

For recombinant expression of At3g60800, several systems can be considered, each with specific advantages:

Expression SystemAdvantagesLimitationsRecommended Tags
E. coliHigh yield, cost-effective, rapidMay not properly fold membrane proteinsSUMO, MBP, Trx
Yeast (S. cerevisiae)Eukaryotic processing, suitable for functional assaysLower yield than E. coliHis6, FLAG
Insect cellsAdvanced eukaryotic processingMore expensive, technically demandingHis6, Strep-tag II
Plant expression (N. benthamiana)Native-like processing environmentVariable yields, labor-intensiveGFP, His6, FLAG

For plant membrane proteins like At3g60800, transient expression in Nicotiana benthamiana leaves may offer a particularly suitable approach as it provides a native-like environment that supports proper folding and post-translational modifications . This system has been successfully used for expressing and analyzing other Arabidopsis proteins, including PAT20, which was obtained by expressing a genomic fragment in N. benthamiana and then re-amplifying from cDNA .

What purification strategies are effective for recombinant At3g60800?

Purifying membrane-associated proteins like At3g60800 presents significant challenges due to their hydrophobic nature. A systematic purification approach would typically involve:

  • Membrane fraction isolation: Differential centrifugation to separate cellular compartments

  • Detergent solubilization: Using mild detergents like DDM, LMNG, or digitonin to extract the protein while maintaining its native conformation

  • Affinity chromatography: Utilizing fusion tags (His6, FLAG, etc.) for selective capture

  • Size exclusion chromatography: For further purification and buffer exchange

When working with recombinant At3g60800, it's crucial to verify that the purified protein retains its DHHC-dependent S-acyltransferase activity. This can be assessed through autoacylation assays or by testing activity against known PAT substrates such as ROP6 or CBL proteins .

How can the enzymatic activity of recombinant At3g60800 be assayed?

Several complementary approaches can be employed to assay the enzymatic activity of recombinant At3g60800:

  • Autoacylation assay: Incubating the purified enzyme with radiolabeled palmitoyl-CoA or azido-palmitoyl-CoA followed by detection of incorporated label

  • Substrate acylation assay: Using known or putative substrate proteins and detecting the transfer of labeled acyl groups

  • Click chemistry-based detection: Utilizing alkyne or azide-modified fatty acids that can be coupled to fluorescent reporters after incorporation

  • Yeast complementation assay: Testing if At3g60800 can rescue the phenotypes of yeast PAT mutants (similar to how TIP1/AtPAT24 complements the akr1Δ yeast strain)

When designing activity assays, it's essential to include appropriate controls, particularly a catalytically inactive mutant where the cysteine in the DHHC motif is substituted (typically to alanine or serine), as this residue is critical for enzymatic function .

How can I identify potential protein substrates of At3g60800?

Identifying the substrate specificity of individual PATs remains challenging but several complementary approaches can be employed:

ApproachMethodologyAdvantagesLimitations
Proximity-based labelingUsing BioID or APEX2 fusions to identify proteins in close proximity to At3g60800In vivo approach, captures transient interactionsMay identify non-substrate interactors
Palmitoyl-proteomicsAcyl-biotin exchange or click chemistry to identify proteins with altered S-acylation in At3g60800 mutantsGlobal analysis of S-acylation changesLabor-intensive, requires sensitive mass spectrometry
Yeast two-hybridTesting direct interactions between At3g60800 and candidate substratesCan identify direct bindingHigh false-positive/negative rates with membrane proteins
In vitro acylation assaysTesting acylation of purified candidate proteins by At3g60800Direct evidence of enzyme-substrate relationshipRequires prior knowledge of potential substrates

PATs in Arabidopsis have shown diverse substrate specificities. For example, studies on the lipid modifications of ROP6 and the Calcineurin-B like (CBL) proteins have revealed that different plant PATs modify distinct substrates . Identifying the specific targets of At3g60800 would provide crucial insights into its biological functions.

What computational approaches can predict the structure and function of At3g60800?

Modern computational approaches can provide valuable insights into At3g60800 structure and function:

  • Homology modeling: Using known structures of DHHC proteins as templates to predict At3g60800 structure

  • Molecular dynamics simulations: Investigating protein-membrane interactions and substrate binding mechanisms

  • Sequence conservation analysis: Identifying conserved residues beyond the DHHC motif that might be functionally important

  • Co-expression network analysis: Identifying genes with expression patterns correlated with At3g60800 to infer functional relationships

  • Phylogenetic analysis: Positioning At3g60800 within the evolutionary context of the PAT family may provide clues to its specific functions

The phylogenetic relationships among Arabidopsis PATs reveal distinct clades with potentially specialized functions . Determining where At3g60800 fits within this evolutionary framework could provide insights into its functional specialization.

How can T-DNA insertion or CRISPR-generated mutants of At3g60800 be analyzed?

T-DNA insertion lines targeting At3g60800 are valuable tools for functional analysis. According to the search results, there is a T-DNA insertion line called GK-153A10-012818 that indicates an insertion close to or within gene At3g60800 . This existing resource can be utilized for functional studies.

When analyzing At3g60800 mutants, a comprehensive characterization approach should include:

  • Molecular verification: Confirming T-DNA insertion or CRISPR-induced mutations through PCR genotyping and sequencing

  • Expression analysis: Quantifying transcript levels to confirm gene disruption

  • Phenotypic characterization: Examining growth, development, and stress responses across different stages and conditions

  • Cellular analysis: Investigating subcellular protein localization and membrane organization

  • Complementation tests: Reintroducing wild-type or mutated At3g60800 to confirm phenotype specificity

  • Biochemical analysis: Assessing changes in the S-acylation status of potential substrate proteins

When designing phenotypic analyses, it's important to consider potential functional redundancy with other PAT family members, which might necessitate the generation of higher-order mutants to observe clear phenotypes.

How should contradictory results in At3g60800 functional studies be addressed?

When encountering contradictory results in At3g60800 studies, a systematic troubleshooting approach is recommended:

  • Validate genetic materials: Confirm the identity and integrity of mutant lines through genotyping and sequencing

  • Assess genetic background effects: Compare phenotypes across different ecotypes or after backcrossing

  • Control environmental conditions: Standardize growth conditions to minimize environmental variability

  • Examine developmental timing: Characterize phenotypes across multiple developmental stages

  • Use multiple experimental approaches: Combine genetic, biochemical, and cell biological methods to build a consensus view

It's also important to consider potential alternative splicing of At3g60800, as seen with AtPAT23, which exhibits tissue-specific splicing variants that affect protein function . This phenomenon could explain discrepancies in experimental results if different tissues or conditions are being examined.

What statistical approaches are most appropriate for analyzing At3g60800 expression data?

When analyzing expression data for At3g60800:

  • For qRT-PCR data: Use the 2^(-ΔΔCT) method with appropriate reference genes verified for stability across experimental conditions

  • For RNA-seq data: Apply normalization methods like DESeq2 or edgeR, with false discovery rate correction for multiple testing

  • For tissue-specific expression: Consider mixed-effects models that account for both biological and technical variability

  • For temporal expression patterns: Time-series analysis methods may be appropriate to identify significant trends

Statistical power analysis should be conducted prior to experiments to determine appropriate sample sizes, especially when expecting subtle expression changes in specific tissues or conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.