Recombinant Arabidopsis thaliana Probable S-acyltransferase At4g15080 (At4g15080)

Shipped with Ice Packs
In Stock

Description

Protein Overview

PAT19 belongs to the DHHC-Cysteine-Rich Domain (DHHC-CRD) family of protein S-acyltransferases (PATs). These enzymes catalyze the addition of fatty acids (typically palmitate) to cysteine residues of target proteins through a two-step ping-pong mechanism . Key features include:

AttributeSpecification
Gene NamePAT19 (At4g15080)
UniProt IDQ8L5Y5
SpeciesArabidopsis thaliana
Expression HostEscherichia coli (E. coli)
TagN-terminal His tag
Protein LengthFull-length (1–718 amino acids)
Molecular Weight~79 kDa
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0); lyophilized powder

Recombinant Expression and Purification

PAT19 is expressed in E. coli using codon-optimized constructs, yielding soluble protein with a His tag for affinity chromatography . Key parameters include:

  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability.

  • Yield: High-yield purification (>90% purity) achieved via immobilized metal-ion affinity chromatography (IMAC) .

Role in S-Acylation

PAT19 mediates S-acylation (palmitoylation) of target proteins, influencing:

  • Membrane anchoring: Enhances hydrophobicity of soluble proteins (e.g., ROPs, CBLs) .

  • Protein trafficking: Regulates cellulose synthase (CESA) complexes in cell wall synthesis .

  • Stress responses: Modulates signaling pathways under abiotic/biotic stress .

Substrate Specificity

  • Targets include soluble proteins (e.g., RIN4, BSK kinases) and transmembrane proteins (e.g., RLKs) .

  • Preferential acylation sites: Cysteine residues in variable regions (e.g., VR2 of CESA4/7/8) .

Research Applications

  • Mechanistic studies: Elucidating S-acylation kinetics and substrate specificity .

  • Structural biology: Purified PAT19 enables cryo-EM or X-ray crystallography studies .

  • Biotechnological engineering: Enhancing stress tolerance in crops via targeted protein modification .

Comparative Analysis of Arabidopsis PATs

PAT19 clusters within the PAT family’s phylogenetic Group C, sharing homology with AtPAT24 . Key distinctions include:

PAT Family MemberSubcellular LocalizationNotable Substrates
PAT19 (At4g15080)Plasma membraneCESA complexes, RIN4
PAT24 (At5g05070)Golgi apparatusUncharacterized
PAT10 (At3g09320)Endoplasmic reticulumROP GTPases

Future Directions

  • Functional genomics: CRISPR-based knockout screens to identify PAT19-dependent pathways.

  • Proteomics: Mapping S-acylated substrates using acyl-RAC or click chemistry .

  • Structural studies: Resolving PAT19’s 3D structure to guide enzyme engineering .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PAT19; At4g15080; dl3585c; FCAALL.183; Probable protein S-acyltransferase 19; Probable palmitoyltransferase At4g15080; Zinc finger DHHC domain-containing protein At4g15080
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-718
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PAT19
Target Protein Sequence
MVRKHGWQLPAHKFQVVAITVFCLLSVAYYAFFAPFVGGRIWEYILLGVYSPVALIVFVL YVRCTAINPADPGIMSKFERGASRGGDLPTAKDISRKFDETGSHLQSSPSVASRTSTLPN SSVKGSVGDAQRVEAAKRKSCFNPLAICCGVFVYEDCRSKEETDEQQGDREEALFCTLCN AEVRKFSKHCRSCDKCVDCFDHHCRWLNNCVGRKNYMTFISLMAVSLLWLLIEAGVGIAV IVRVFVNKKDMETEIVNRLGNGFSRAPFATVVGLCTAVSMLALFPLGELFFFHMLLIKKG ITTYEYVVAMRAMSEAPAGASIDEEIPNVLYSPSGSATTGFSGGSSLGLPYKGAWCTPPR VFVDYQDEVIPHLDPRMVPSTVDPDAAETAERGNKIPKRPVKISAWKLAKLNSNEATRAA ARARASSSVLRPIENRHLHDDELSSRSGTISVVSSVSTEANGATLSREIRNNDPMLSHCR NSYAPSQGSRDEYDTGTHSMSSLSSPSHVHETVTLSPLPQHHTAGHRFTAAAASNSSRPP LNQATNHMIHSTFDEKIMQKGNHADPLLLPAPAASLLRDVRRTSVVWDQEAGRYISVPAT TSEPRTRFSSQNQPIPSSHMGNTQNPRPVGHPPQDSSSGRAPPPTQQQQGERLMYTGESI FFGGPLVNIPNRDGLRHDGDSGREGQDRMTLTLPREARFKRDTTSNQLPVFAPVGTRK
Uniprot No.

Target Background

Function
Palmitoyl acyltransferase.
Database Links

KEGG: ath:AT4G15080

STRING: 3702.AT4G15080.1

UniGene: At.33215

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the significance of Arabidopsis thaliana as a model organism for studying At4g15080?

Arabidopsis thaliana has become the most widely studied plant in modern biology due to its numerous advantages for research. It offers a rapid life cycle (completing its life cycle from seed to mature seeds in as few as 6 weeks), small stature, and modest growth requirements, making it ideal for laboratory cultivation. When studying At4g15080, these characteristics allow for faster experimental timelines and more controlled conditions compared to other plant models .

Additionally, Arabidopsis has a relatively small genome that has been fully sequenced, with standardized gene naming conventions. At4g15080 follows this convention, where "At" indicates Arabidopsis thaliana, "4" refers to chromosome 4, and "g15080" provides the unique identifier reflecting its chromosomal position . This standardization facilitates comparative genomic analyses and integration with existing Arabidopsis research data.

What are the primary functions of S-acyltransferases in Arabidopsis thaliana?

S-acyltransferases in Arabidopsis thaliana catalyze the transfer of fatty acid groups to cysteine residues of target proteins, a post-translational modification known as S-acylation or palmitoylation. This modification is reversible and regulates protein localization, stability, and function within the cell. In the specific case of At4g15080, as a probable S-acyltransferase, it likely contributes to the regulation of membrane-associated proteins and signaling pathways.

How can I confirm the S-acyltransferase activity of recombinant At4g15080?

Confirming the S-acyltransferase activity of recombinant At4g15080 requires a systematic approach using both in vitro and in vivo assays:

  • Heterologous expression: Clone the At4g15080 gene into an expression vector and express it in a system such as Escherichia coli or yeast. The recombinant protein should be tagged (e.g., with His or GST) for purification purposes.

  • In vitro enzyme assays: Purify the recombinant At4g15080 and conduct enzyme assays using radiolabeled acyl-CoA donors (like [14C]-palmitoyl-CoA) and appropriate protein substrates. Detection of incorporated radioactivity in the substrate proteins would indicate S-acyltransferase activity.

  • Substrate identification: To identify potential substrates, you can employ either targeted approaches testing candidate proteins or use proteomics methods to identify proteins that become S-acylated in the presence of active At4g15080.

  • Activity validation: Similar to approaches used for other transferases like AT1G78690, mass spectrometry (ESI-MS and MS/MS) can be employed to analyze reaction products and confirm the precise nature of the modification .

How can I determine the substrate specificity of At4g15080 compared to other S-acyltransferases in Arabidopsis?

Determining substrate specificity of At4g15080 requires a comprehensive approach:

  • Structural analysis: Perform computational modeling of At4g15080 based on crystal structures of related S-acyltransferases. Identify potential substrate binding regions and catalytic domains.

  • Acyl-CoA preference assay: Test the activity of purified recombinant At4g15080 with various acyl-CoA donors (varying in chain length and saturation) to determine acyl chain preference. Quantify activity using the following experimental design:

Acyl-CoA DonorChain LengthSaturationRelative Activity (%)Km (μM)Vmax (nmol/min/mg)
Acetyl-CoAC2Saturated[Experimental data][Data][Data]
Butyryl-CoAC4Saturated[Experimental data][Data][Data]
Palmitoyl-CoAC16Saturated[Experimental data][Data][Data]
Stearoyl-CoAC18Saturated[Experimental data][Data][Data]
Oleoyl-CoAC18Unsaturated[Experimental data][Data][Data]
  • Protein substrate profiling: Employ a proteomics approach using stable isotope labeling (SILAC) to compare proteins that become S-acylated in wild-type plants versus At4g15080 overexpression lines or knockout mutants.

  • Comparative analysis: Unlike the study of AT1G78690, which revealed its function was misannotated (it actually acylates lysoglycerophospholipids rather than performing N-acylation) , your analysis should confirm whether At4g15080 is indeed an S-acyltransferase and determine its specific subset of targets compared to other S-acyltransferases in Arabidopsis.

What are the molecular consequences of At4g15080 knockout or overexpression in Arabidopsis thaliana?

Investigating the molecular consequences of At4g15080 manipulation requires a multi-omics approach:

  • Generate genetic resources: Create knockout mutants using CRISPR/Cas9 gene editing and overexpression lines using Agrobacterium-mediated transformation. Both approaches are well-established in Arabidopsis .

  • Phenotypic characterization: Analyze growth, development, stress responses, and other physiological parameters across various growth conditions. Document any visible phenotypes systematically.

  • Global protein S-acylation profiling: Use acyl-biotin exchange (ABE) or acyl-resin-assisted capture (acyl-RAC) methods followed by mass spectrometry to quantify global changes in the S-acylation proteome.

  • Transcriptome analysis: Perform RNA-sequencing to identify differentially expressed genes in response to At4g15080 manipulation. This can reveal downstream pathways affected by altered S-acylation patterns.

  • Metabolome analysis: Analyze changes in lipid and metabolite profiles, particularly focusing on pathways potentially regulated by S-acylated proteins.

  • Integrate data: Create a comprehensive model of At4g15080 function by integrating phenotypic, transcriptomic, proteomic, and metabolomic data.

How can I resolve contradictory data regarding At4g15080 subcellular localization and activity?

Resolving contradictory data about At4g15080 requires systematic investigation across multiple experimental approaches:

  • Fluorescent protein fusion analysis: Create both N- and C-terminal fluorescent protein fusions (e.g., GFP, mCherry) of At4g15080 and examine their localization using confocal microscopy. Be aware that tag position may affect localization, so both orientations should be tested.

  • Subcellular fractionation: Perform careful biochemical fractionation of cellular components followed by western blotting using antibodies against At4g15080 or its tags.

  • Immunogold electron microscopy: For highest resolution localization, use immunogold labeling with antibodies against At4g15080 and electron microscopy.

  • Functional complementation: Test whether the fluorescent fusion proteins can complement the phenotype of At4g15080 knockout mutants to ensure that fusion proteins retain functionality.

  • Organelle markers: Co-express At4g15080 fusions with established organelle markers to precisely determine localization.

  • Activity assays with subcellular fractions: Isolate different membrane fractions and determine where S-acyltransferase activity is highest.

  • Systematic documentation: Create a comprehensive table documenting all experimental conditions and results to identify patterns that may explain contradictions:

Experimental ApproachConstruct DesignExpression SystemObserved LocalizationActivity DetectedPotential Limitations
GFP-fusion (N-terminal)[Details]Transient expression[Result][Yes/No/Partial][Notes]
GFP-fusion (C-terminal)[Details]Stable transgenic lines[Result][Yes/No/Partial][Notes]
Subcellular fractionationNative proteinArabidopsis tissue[Result][Yes/No/Partial][Notes]
Immunogold EMNative proteinArabidopsis tissue[Result]N/A[Notes]

What is the optimal expression system for producing active recombinant At4g15080?

Selecting the optimal expression system for At4g15080 requires considering several factors:

  • Bacterial expression (E. coli):

    • Advantages: Rapid growth, high yield, simple culture conditions

    • Limitations: Lacks post-translational modifications, may form inclusion bodies

    • Optimization: Test multiple strains (BL21, Rosetta, etc.), fusion tags (His, MBP, GST), and induction conditions (temperature, IPTG concentration)

    • Similar approach to AT1G78690 expression, which was successfully overexpressed in E. coli for functional characterization

  • Yeast expression (S. cerevisiae or P. pastoris):

    • Advantages: Eukaryotic system with some post-translational modifications, moderate yield

    • Limitations: Longer cultivation time than bacteria

    • Optimization: Test codon-optimized constructs and various promoters

  • Insect cell expression (Baculovirus system):

    • Advantages: More complex eukaryotic system with improved protein folding

    • Limitations: Technical complexity, higher cost

    • Optimization: Test multiple cell lines and infection conditions

  • Plant expression systems:

    • Advantages: Native environment for the protein, all appropriate modifications

    • Methods: Agroinfiltration in Nicotiana benthamiana or stable transformation in Arabidopsis

    • Limitations: Lower yield, longer timeframe

Based on research with similar enzymes, a recommended approach would be to start with E. coli expression for initial biochemical characterization, followed by validation in a plant system to confirm native activity. The successful expression of AT1G78690 in E. coli suggests this approach may be effective for At4g15080 as well .

How should I design experiments to identify specific protein targets of At4g15080?

Identifying protein targets of At4g15080 requires a multi-faceted approach:

  • Biotin-switch technique (BST): This three-step protocol includes:

    • Blocking free thiols with N-ethylmaleimide (NEM)

    • Cleaving thioester bonds with hydroxylamine

    • Labeling newly exposed thiols with biotin-HPDP

    • Enriching biotinylated proteins with streptavidin affinity purification

    • Analyzing via mass spectrometry

  • Acyl-resin-assisted capture (Acyl-RAC): A variation of BST that uses thiopropyl Sepharose to capture formerly S-acylated proteins.

  • Metabolic labeling: Use of alkyne-fatty acids (like 17-ODYA) followed by click chemistry to attach detection tags.

  • Comparative proteomics design:

Experimental GroupGenetic BackgroundTreatmentExpected Outcome
ControlWild-type ArabidopsisMockBaseline S-acylation profile
ExperimentalAt4g15080 knockoutMockReduced S-acylation of specific targets
ExperimentalAt4g15080 overexpressionMockEnhanced S-acylation of specific targets
Control + inhibitorWild-type ArabidopsisS-acylation inhibitorGlobal reduction in S-acylation
  • Validation of direct interaction: Use protein-protein interaction methods such as:

    • Yeast two-hybrid screening

    • Pull-down assays with recombinant At4g15080

    • Bimolecular fluorescence complementation (BiFC)

    • Förster resonance energy transfer (FRET)

  • In vitro confirmation: Test S-acylation of candidate proteins using purified recombinant At4g15080 and radiolabeled acyl-CoA.

What are the best approaches for studying At4g15080 activity in planta?

Studying At4g15080 activity in planta requires techniques that maintain the native cellular context:

  • Genetic resources: Generate multiple genetic resources using Arabidopsis transformation techniques :

    • Knockout mutants using CRISPR/Cas9

    • RNAi lines for partial knockdown

    • Overexpression lines under constitutive (35S) or inducible promoters

    • Tissue-specific expression using appropriate promoters

    • Complementation lines expressing At4g15080 in knockout background

  • Activity-based protein profiling (ABPP): Design activity-based probes that react with active S-acyltransferases to monitor At4g15080 activity in living plants.

  • Quantitative S-acylation assays: Adapt methods like the biotin-switch technique for quantitative analysis of S-acylation levels in wild-type versus genetic variants.

  • Live-cell imaging: Create split-GFP or FRET-based sensors to visualize At4g15080 activity in real-time within living plant cells.

  • Stress response studies: Monitor At4g15080 activity under various stress conditions (temperature, drought, salinity, pathogens) to understand its role in stress adaptation.

  • Developmental timeline: Track At4g15080 expression and activity throughout Arabidopsis development to identify stage-specific functions:

Developmental StageAt4g15080, Expression LevelActivity LevelAssociated Phenotypes in Knockout
Seed germination[Data][Data][Observations]
Seedling establishment[Data][Data][Observations]
Vegetative growth[Data][Data][Observations]
Flowering[Data][Data][Observations]
Seed development[Data][Data][Observations]

How can I distinguish between direct and indirect effects of At4g15080 on cellular processes?

Distinguishing direct from indirect effects requires careful experimental design:

  • Temporal analysis: Monitor changes following inducible expression of At4g15080 using an estrogen-inducible or dexamethasone-inducible system. Early changes (minutes to hours) are more likely to be direct effects, while later changes (days) may represent secondary responses.

  • Catalytic dead mutants: Create point mutations in the catalytic site of At4g15080 to generate an inactive enzyme. Compare phenotypes between plants expressing active versus inactive versions to distinguish between catalytic and scaffolding functions.

  • Direct target validation: For each putative target protein, confirm direct S-acylation by At4g15080 using in vitro assays with purified components.

  • Substrate mutation studies: For confirmed target proteins, mutate the S-acylation sites (cysteine residues) and express these mutant proteins in plants to determine if the observed phenotypes can be recapitulated.

  • Pharmacological approach: Use S-acylation inhibitors like 2-bromopalmitate alongside genetic approaches to determine if chemical inhibition produces similar phenotypes to genetic manipulation.

  • Network analysis: Create a hierarchical model of transcriptional, proteomic, and metabolic changes following At4g15080 manipulation to identify immediate versus downstream effects.

What bioinformatic tools are most effective for analyzing the evolutionary conservation of At4g15080 across plant species?

Effective evolutionary analysis of At4g15080 requires multiple bioinformatic approaches:

  • Sequence alignment tools:

    • Perform multiple sequence alignment using MUSCLE, MAFFT, or T-Coffee

    • Use progressive alignment strategies for large datasets

    • Include S-acyltransferases from diverse plant species, including basal angiosperms like Amborella trichopoda , monocots, and eudicots

  • Phylogenetic analysis:

    • Construct phylogenetic trees using maximum likelihood (RAxML, IQ-TREE) or Bayesian inference (MrBayes)

    • Test multiple evolutionary models and select the best fit

    • Perform bootstrap analysis (1000 replicates) to assess branch support

  • Synteny analysis:

    • Examine the genomic context of At4g15080 homologs across species

    • Use tools like SynMap or MCScanX to visualize syntenic relationships

    • Determine if gene order is conserved, suggesting functional importance

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify signatures of purifying, neutral, or positive selection

    • Use PAML or HyPhy packages for codon-based analyses

    • Identify specific residues under selection

  • Domain conservation:

    • Identify conserved catalytic domains and substrate-binding regions

    • Compare conservation patterns between these functional regions and other parts of the protein

  • Comprehensive visualization: Create an evolutionary conservation heat map showing sequence conservation across plant lineages:

How should I interpret conflicting results between in vitro and in vivo studies of At4g15080?

Interpreting conflicting results requires systematic analysis of potential sources of variation:

  • Protein conformation and modification:

    • In vitro studies may lack post-translational modifications present in vivo

    • Recombinant proteins may not fold correctly outside their native environment

    • Solution: Compare the biochemical properties of plant-purified versus recombinant At4g15080

  • Co-factor availability:

    • Essential co-factors may be missing in in vitro systems

    • Solution: Supplement in vitro reactions with plant cell extracts or test additional co-factors

  • Membrane environment:

    • As an S-acyltransferase, At4g15080 likely functions in membrane environments

    • Solution: Incorporate appropriate membrane mimetics (liposomes, nanodiscs) in in vitro assays

  • Substrate accessibility:

    • In cells, substrate availability is regulated by localization and interactions

    • Solution: Develop more sophisticated in vitro systems that better mimic cellular compartmentalization

  • Experimental conditions:

    • pH, ionic strength, and temperature may differ between systems

    • Solution: Systematically vary conditions to identify optimal parameters

  • Integrative analysis: Create a comprehensive comparison table to identify patterns in the discrepancies:

Aspect of At4g15080 FunctionIn Vitro ObservationIn Vivo ObservationPotential ExplanationReconciliation Strategy
Substrate specificity[Data][Data][Analysis][Approach]
Catalytic rate[Data][Data][Analysis][Approach]
Regulatory mechanisms[Data][Data][Analysis][Approach]
Interaction partners[Data][Data][Analysis][Approach]

How can research on At4g15080 contribute to our understanding of plant stress responses?

Research on At4g15080 can provide valuable insights into plant stress responses:

  • Stress-responsive S-acylation: Monitor changes in At4g15080 expression and activity under various stress conditions (drought, salt, cold, heat, pathogens) to determine if S-acylation is dynamically regulated during stress.

  • Identification of stress-related targets: Compare the S-acylation proteome under normal versus stress conditions in wild-type and At4g15080 mutant plants to identify stress-specific targets.

  • Signaling pathway integration: Determine how At4g15080-mediated S-acylation interfaces with known stress signaling pathways, such as ABA signaling, MAPK cascades, or calcium signaling.

  • Membrane dynamics: Investigate how At4g15080-mediated S-acylation affects membrane properties and organization during stress, particularly in specialized membrane domains like lipid rafts.

  • Stress tolerance engineering: Evaluate whether manipulating At4g15080 expression can enhance stress tolerance in Arabidopsis and potentially in crop plants.

  • Experimental design: Create a comprehensive stress response matrix to systematically evaluate At4g15080 function:

Stress ConditionAt4g15080 Expression ChangeGlobal S-acylation ChangesPhenotype in KnockoutPhenotype in Overexpression
Drought (moderate)[Data][Data][Observations][Observations]
Drought (severe)[Data][Data][Observations][Observations]
Salt stress[Data][Data][Observations][Observations]
Cold stress[Data][Data][Observations][Observations]
Heat stress[Data][Data][Observations][Observations]
Pathogen infection[Data][Data][Observations][Observations]

What methodological advances would improve the study of S-acyltransferases like At4g15080?

Several methodological advances would significantly enhance research on At4g15080:

  • Improved detection methods:

    • Development of specific antibodies against At4g15080

    • Creation of activity-based probes for S-acyltransferases

    • Enhanced mass spectrometry techniques for detecting S-acylation with higher sensitivity

  • Advanced imaging:

    • Super-resolution microscopy to visualize S-acylation events at the nanoscale

    • Label-free imaging methods to avoid artifacts from protein tagging

    • Real-time imaging of S-acylation dynamics in living cells

  • Genetic tools:

    • Inducible, tissue-specific CRISPR systems for spatiotemporal control of gene editing

    • Multiplexed genome editing to target multiple S-acyltransferases simultaneously

    • Base editing technologies for introducing specific mutations

  • Structural biology approaches:

    • Cryo-EM studies of At4g15080 in native membrane environments

    • Hydrogen-deuterium exchange mass spectrometry to study conformational dynamics

    • Computational modeling and molecular dynamics simulations

  • Single-cell technologies:

    • Single-cell proteomics to detect cell-specific S-acylation events

    • Single-cell transcriptomics to identify cell-type-specific responses to At4g15080 manipulation

  • Artificial intelligence applications:

    • Machine learning for prediction of S-acylation sites and substrates

    • Pattern recognition in large datasets to identify regulatory networks

How might findings from At4g15080 research translate to agricultural applications?

Research on At4g15080 has several potential agricultural applications:

  • Stress tolerance improvement:

    • If At4g15080 positively regulates stress responses, overexpression or enhancement of its activity could improve crop tolerance to environmental stresses

    • Targeted modification of key S-acylation sites in stress-response proteins might improve their function

  • Growth and development optimization:

    • Understanding how At4g15080 regulates developmental processes could lead to crops with improved architecture or growth characteristics

    • Manipulation of S-acylation could potentially alter flowering time, seed development, or yield components

  • Pathogen resistance:

    • If At4g15080 regulates immune responses, enhancing its function could improve disease resistance

    • S-acylation of immune receptors might be targeted to enhance pathogen recognition

  • Translational research strategy:

    • Identify At4g15080 homologs in crop species

    • Validate function in model crop systems

    • Test targeted modifications in field trials

    • Develop non-transgenic approaches using TILLING or base editing

  • Predictive modeling for crop improvement:

    • Develop computational models that predict how alterations in S-acylation patterns will affect plant phenotypes

    • Use these models to guide precision breeding approaches

  • Comparative analysis in crops: Create a systematic analysis of At4g15080 homologs across major crop species:

Crop SpeciesGene ID of At4g15080 HomologSequence Identity (%)Expression PatternKnown FunctionsPotential Agricultural Applications
Rice (Oryza sativa)[ID][Data][Data][Data][Analysis]
Maize (Zea mays)[ID][Data][Data][Data][Analysis]
Wheat (Triticum aestivum)[ID][Data][Data][Data][Analysis]
Soybean (Glycine max)[ID][Data][Data][Data][Analysis]
Tomato (Solanum lycopersicum)[ID][Data][Data][Data][Analysis]

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.