Recombinant Arabidopsis thaliana Probable S-acyltransferase At4g22750 (At4g22750)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

Protein S-acyltransferase At4g22750, commonly known as PAT13, belongs to a family of enzymes that catalyze the addition of fatty acids to proteins through thioester bonds at cysteine residues. PAT13 is encoded by the At4g22750 gene located on chromosome 4 of Arabidopsis thaliana, a model organism widely used in plant molecular biology research. The enzyme is classified as a member of the DHHC (Asp-His-His-Cys) domain-containing protein family, a conserved group of S-acyltransferases found across eukaryotes .

Within the Arabidopsis genome, PAT13 is one of 24 identified PAT proteins that collectively regulate the S-acylation status of numerous target proteins. According to genomic analyses, PAT13 is officially designated with the locus name At4g22750 and alternative ORF names T12H17.140 and T12H17.2 . In protein databases, it is recognized by UniProt accession number Q94C49 and is annotated as a "Probable protein S-acyltransferase 13" or "Probable palmitoyltransferase At4g22750" .

The evolutionary conservation of PAT13 across plant species suggests its fundamental importance in plant cellular functions. Homology analyses have revealed significant similarities between PAT13 and other S-acyltransferases, particularly with PAT14 (At3g60800), with which it shares functional redundancy in certain physiological processes .

Physical and Chemical Properties

PAT13 has a calculated molecular weight of approximately 34 kDa (33,548 Da specifically) . As a membrane-associated protein, it possesses hydrophobic regions that facilitate its integration into cellular membranes. The protein's structural analysis indicates the presence of multiple transmembrane domains that anchor it within the membrane bilayer, positioning the catalytic DHHC domain optimally for interaction with substrate proteins .

The table below summarizes the key physical and chemical properties of PAT13:

PropertyValue
Protein Length302 amino acids
Molecular Weight33,548 Da
Gene IdentifierAt4g22750
UniProt AccessionQ94C49
Enzyme ClassificationEC 2.3.1.-
Catalytic DomainDHHC zinc finger
Cellular LocalizationMembrane-associated

Expression Systems and Purification

Recombinant PAT13 has been successfully expressed in Escherichia coli expression systems . The full-length protein (amino acids 1-302) is typically fused with an N-terminal histidine tag to facilitate purification through affinity chromatography . The expression in bacterial systems has enabled the production of sufficient quantities of the protein for biochemical and functional studies.

The recombinant protein is commonly purified using immobilized metal affinity chromatography (IMAC), leveraging the high affinity of the histidine tag for metal ions such as nickel or cobalt. Following purification, the protein is typically obtained in high purity (>90% as determined by SDS-PAGE) .

Catalytic Mechanism of S-acylation

PAT13 functions as a protein S-acyltransferase, catalyzing the addition of fatty acids (predominantly palmitate) to cysteine residues of target proteins via thioester bonds . This post-translational modification, known as S-acylation or palmitoylation, is reversible and plays crucial roles in regulating protein localization, trafficking, and function .

The catalytic mechanism involves the transfer of an acyl group (typically a 16-carbon palmitate) from acyl-CoA to the sulfhydryl group of a cysteine residue in the target protein. The DHHC motif within the zinc finger domain is essential for this catalytic activity, with the cysteine residue in this motif likely forming an acyl-enzyme intermediate during the reaction process .

Substrate Specificity and Targeting

While the complete substrate profile of PAT13 remains to be fully characterized, research has identified NITRIC OXIDE ASSOCIATED 1 (NOA1) as one of its physiological substrates . The S-acylation of NOA1 by PAT13 (and its homolog PAT14) affects NOA1's subcellular localization, particularly its association with chloroplasts .

The substrate recognition by PAT13 likely involves specific protein-protein interactions that determine its selectivity. Bioinformatics analyses and experimental approaches such as the Acyl-RAC assay have been employed to identify potential S-acylation substrates of PAT13 . The specificity of PAT13 appears to overlap with that of PAT14, explaining their functional redundancy in certain biological processes .

Role in Leaf Senescence

One of the most significant functions of PAT13 is its involvement in regulating leaf senescence in Arabidopsis thaliana . Research has demonstrated that the expression of PAT13 and its homolog PAT14 increases moderately in older leaves, suggesting their role in age-dependent processes .

The double mutant of PAT13 and PAT14 (pat13-1pat14-1) displays a severe early leaf senescence phenotype, characterized by premature yellowing and degradation of leaf tissues . This phenotype was effectively complemented by overexpression of either PAT13 or PAT14 in the double mutant, confirming the specific roles of these proteins in senescence regulation .

Importantly, the levels of reactive oxygen species (ROS) and cell death were dramatically increased in the pat13-1pat14-1 double mutant, indicating that PAT13 and PAT14 function in suppressing uncontrolled cell death pathways and oxidative stress responses that accelerate senescence .

Regulation of Protein Localization and Function

The S-acylation activity of PAT13 has significant impacts on the subcellular localization and function of its substrate proteins. A notable example is NOA1, which normally localizes to chloroplasts in wild-type plants . In the pat13-1pat14-1 double mutant, approximately 31% of cells showed mislocalization of NOA1, suggesting that S-acylation by PAT13/PAT14 is partially required for proper chloroplast targeting of this protein .

Through Acyl-RAC assays, NOA1 was confirmed as an S-acylation substrate, with reduced S-acylation levels observed in the pat13-1pat14-1 mutant compared to wild-type plants . Further research involving site-directed mutagenesis of potential S-acylation sites (Cys107 and Cys108) on NOA1 demonstrated that these modifications affect both the protein's subcellular localization and its function in leaf senescence control .

Tool for Studying Protein S-acylation

Recombinant PAT13 serves as a valuable tool for investigating the mechanisms and specificity of protein S-acylation in plants. In vitro acylation assays using purified recombinant PAT13 can help identify potential substrates and characterize the enzymatic properties of this S-acyltransferase .

The availability of well-characterized recombinant PAT13 has facilitated the development of antibodies and assays for detecting and quantifying this protein in plant tissues. These tools are essential for studies examining the expression, localization, and activity of PAT13 under various physiological conditions .

Model for Understanding Membrane Protein Regulation

Research on PAT13 has provided important insights into how membrane-associated proteins are regulated through reversible lipid modifications. The study of PAT13 and its substrates illustrates the sophisticated mechanisms by which plants control protein localization and function through post-translational modifications .

This knowledge has broader implications for understanding membrane protein dynamics in eukaryotes, as the mechanisms of S-acylation are conserved across species. Comparative studies between plant PATs like PAT13 and their mammalian counterparts can reveal both conserved and divergent aspects of this regulatory mechanism .

Potential Biotechnological Applications

Understanding the function of PAT13 in processes such as leaf senescence opens potential avenues for agricultural applications. Manipulating the activity or expression of PAT13 and related S-acyltransferases could potentially be used to:

  1. Modify senescence timing in crops to extend shelf life or optimize harvest periods

  2. Enhance stress tolerance by regulating oxidative stress responses

  3. Control developmental transitions in plants for improved agricultural traits

These potential applications highlight the significance of continued research on PAT13 and other plant S-acyltransferases .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify them in your order remarks. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
In general, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development according to your specifications.
Synonyms
PAT13; At4g22750; T12H17.140; T12H17.2; Probable protein S-acyltransferase 13; Probable palmitoyltransferase At4g22750; Zinc finger DHHC domain-containing protein At4g22750
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PAT13
Target Protein Sequence
MAWNVFKFCTALRALGSIMILIVIGIIGFTYYAVVVVNYGPALLIGGVDSLLSVLVLAFF HFLLIMLLWSYFSVVVTDPGGVPTGWRPELDIEKSEGNQALIGEASVGDSSSHGVRYCRK CNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGANNYKSFLLFLFYTFLETTVVAVSLL PIFLVFFSDGDGDITVSPGSLAASFVAFVLNIAFALSVLGFLIMHIMLVARNTTTIEAYE KHTVNWPYNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDFTSRSESETEPLQ SL
Uniprot No.

Target Background

Function
Palmitoyl acyltransferase.
Database Links

KEGG: ath:AT4G22750

STRING: 3702.AT4G22753.2

UniGene: At.19156

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.