Recombinant Arabidopsis thaliana Probable signal peptidase complex subunit 2 (At2g39960)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
At2g39960; T28M21.12; Probable signal peptidase complex subunit 2; Microsomal signal peptidase 25 kDa subunit; SPase 25 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-192
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At2g39960
Target Protein Sequence
MEEKKTESTNKNVKKANLLDHHSIKHILDESVSDIVTSRGYKEDVRLSNLKLILGTIIIV VALVAQFYNKKFPENRDFLIGCIALYVVLNAVLQLILYTKEKNAILFTYPPEGSFTSTGL VVSSKLPRFSDQYTLTIDSADPKSISAGKSVQLTKSVTQWFTKDGVLVEGLFWKDVEALI KNYAEEEPKKKK
Uniprot No.

Target Background

Function

Microsomal signal peptidase is a membrane-bound endoproteinase responsible for cleaving signal peptides from nascent proteins during their translocation into the endoplasmic reticulum lumen.

Database Links

KEGG: ath:AT2G39960

STRING: 3702.AT2G39960.1

UniGene: At.14665

Protein Families
SPCS2 family
Subcellular Location
Membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of At2g39960 in Arabidopsis thaliana?

At2g39960, also referred to as SPC25 in some research contexts, functions as a component of the signal peptidase complex in Arabidopsis thaliana. This complex is critical for processing newly synthesized proteins in the endoplasmic reticulum by cleaving signal peptides from precursor proteins. The protein is involved in fundamental cellular processes related to protein trafficking and secretion. Signal peptidase activity is essential for proper protein folding and localization, particularly for proteins destined for secretion or membrane insertion .

Why is At2g39960 used as a reference gene in expression studies?

At2g39960 (SPC25) has been utilized as a reference gene for normalizing gene expression data in Arabidopsis studies, particularly in comparative analyses between species such as A. thaliana and C. hirsuta. It is often used alongside other reference genes such as ELONGATION FACTOR 1α (EF1α) and YELLOW-LEAF-SPECIFIC GENE 8 (YLS8) because it shows stable expression across different experimental conditions, making it valuable for accurate quantification of target gene expression . When conducting gene expression studies, using multiple reference genes like SPC25 improves the reliability of normalization and helps minimize experimental variation.

What methods are optimal for recombinant expression of At2g39960?

For recombinant expression of At2g39960, researchers have several options:

  • Bacterial Expression Systems: While simpler to implement, bacterial systems may not provide appropriate post-translational modifications. E. coli BL21(DE3) with pET-based vectors containing a His-tag for purification offers a starting point.

  • Plant-Based Expression: For maintaining native modifications, expression in Arabidopsis seeds using promoters such as β-PHASEOLIN (PPHAS) provides a seed-specific expression system that has been successfully employed for recombinant proteins. This approach allows for proper folding and post-translational modifications in a native-like environment .

  • Insect Cell Expression: Sf9 cells have been used successfully for expression of plant proteins, particularly those involved in protein-protein interactions, as demonstrated with related proteins in the search results .

When designing expression constructs, consider including appropriate tags (His, GST, or MBP) to facilitate purification while monitoring potential interference with protein function.

How can researchers assess the quality of recombinant At2g39960 preparations?

Quality assessment of recombinant At2g39960 should include multiple analytical methods:

  • SDS-PAGE and Western Blot: To verify size, purity, and integrity of the protein.

  • Mass Spectrometry: For accurate molecular weight determination and identification of post-translational modifications.

  • Circular Dichroism: To assess proper folding and secondary structure.

  • Activity Assays: Signal peptidase activity can be measured using synthetic peptide substrates containing known cleavage sites.

  • Thermal Shift Assays: To evaluate protein stability under different buffer conditions.

Researchers should also verify that the recombinant protein maintains its expected interaction partners through co-immunoprecipitation or yeast two-hybrid assays as appropriate .

What are the recommended controls when working with At2g39960 in expression studies?

When using At2g39960 as a reference gene for expression normalization, the following controls are essential:

  • Multiple Reference Gene Validation: Include additional established reference genes such as EF1α and YLS8 to improve normalization reliability .

  • Stability Testing: Verify expression stability across your specific experimental conditions using tools like geNorm or NormFinder.

  • No-Template Controls: Include in all qPCR experiments to detect contamination.

  • No-RT Controls: To identify genomic DNA contamination in RNA samples.

  • Standard Curves: Generate for accurate quantification and to verify primer efficiency.

For functional studies of At2g39960 itself, appropriate controls would include wild-type comparisons and, when possible, complementation experiments with the recombinant protein to verify functional rescue of mutant phenotypes.

How does At2g39960 participate in the unfolded protein response (UPR) in Arabidopsis?

As a component of the signal peptidase complex, At2g39960 likely plays a role in the cellular response to increased protein synthesis demands and endoplasmic reticulum (ER) stress. In Arabidopsis, the unfolded protein response is triggered when misfolded proteins accumulate in the ER, leading to upregulation of genes involved in protein folding, glycosylation, modification, translocation, vesicle transport, and degradation .

While At2g39960 is not explicitly mentioned as a UPR-regulated gene in the search results, its function in protein processing at the ER suggests it may be integrated into this response pathway. Signal peptidase activity is crucial for proper processing of secretory proteins, and disruptions in this process could potentially contribute to ER stress. Research investigating At2g39960 expression levels during ER stress conditions (e.g., treatment with tunicamycin or DTT) would help clarify its specific role in the UPR pathway .

What methodologies are suitable for studying At2g39960 protein-protein interactions?

Several complementary approaches can be employed to characterize At2g39960 protein-protein interactions:

  • Yeast Two-Hybrid (Y2H): This method has been successfully used for similar proteins as shown in the search results. For At2g39960, constructs should be designed with appropriate fusion domains (AD or BD) and tested in systems similar to those described for other plant proteins .

  • Co-Immunoprecipitation (Co-IP): Using either tagged recombinant proteins or antibodies against the native protein to pull down interaction partners from plant lysates.

  • Bimolecular Fluorescence Complementation (BiFC): For in vivo visualization of protein interactions in plant cells.

  • Microscale Thermophoresis (MST): This technique, mentioned in the search results, provides quantitative binding affinity measurements (KD values) for purified proteins and potential interaction partners .

  • Pull-down Assays: Using recombinant tagged At2g39960 to identify interaction partners from plant extracts, followed by mass spectrometry identification.

When designing these experiments, researchers should consider both transient interactions (which may require crosslinking approaches) and stable complexes, as At2g39960 likely functions as part of the multi-protein signal peptidase complex.

How can researchers generate and characterize At2g39960 mutants in Arabidopsis?

To generate and characterize At2g39960 mutants:

  • T-DNA Insertion Lines: Screen existing collections (SALK, SAIL, GABI-Kat) for insertions in At2g39960. Confirm homozygosity by PCR and verify reduced/absent expression by RT-qPCR.

  • CRISPR/Cas9 Mutagenesis: Design guide RNAs targeting conserved regions of At2g39960, particularly domains essential for catalytic activity or complex formation.

  • RNAi Approaches: Similar to techniques described for other genes in the search results, RNAi constructs can be generated to achieve knockdown of At2g39960 .

  • Phenotypic Characterization:

    • Examine growth phenotypes at different developmental stages

    • Analyze protein secretion using secretory protein markers

    • Assess ER stress markers (BiP, PDI, CALNEXIN) to determine if UPR is activated in mutants

    • Evaluate response to ER stress inducers like tunicamycin

  • Complementation Studies: Reintroduce wild-type or modified versions of At2g39960 to confirm phenotype specificity and investigate structure-function relationships.

How does At2g39960 compare structurally and functionally to homologs in other plant species?

Comparative analysis of At2g39960 across plant species reveals both conserved and divergent features:

  • Sequence Conservation: The signal peptidase complex is evolutionarily conserved, with homologs present across plant species. Sequence alignment and phylogenetic analysis would reveal the degree of conservation in different plant lineages and help identify functionally critical domains.

  • Functional Conservation: While structural conservation suggests functional conservation, experimental validation is necessary. Similar techniques to those used in comparing other genes between A. thaliana and C. hirsuta could be employed, including complementation studies where the At2g39960 gene is expressed in mutant backgrounds of other species to test functional rescue .

  • Expression Pattern Comparison: The stable expression pattern that makes At2g39960 suitable as a reference gene in Arabidopsis may or may not be conserved across species. Comparative expression studies using methods described in the search results would clarify this point .

  • Role in Adaptive Processes: Given the differences observed between species in other molecular pathways (such as the shade avoidance response mentioned in the search results), investigating whether signal peptidase function contributes to adaptive differences between species could be valuable .

What techniques are available for studying At2g39960 expression patterns in different tissues?

Researchers have several options for analyzing At2g39960 expression patterns:

  • RT-qPCR Analysis: Using tissue-specific RNA extractions and gene-specific primers for At2g39960, quantitative expression patterns can be determined across different tissues and developmental stages .

  • Promoter-Reporter Constructs: Fusing the At2g39960 promoter to reporter genes (GUS, GFP) allows visualization of expression patterns in planta.

  • RNA in situ Hybridization: For high-resolution spatial expression analysis within complex tissues.

  • Single-Cell RNA-Seq: To identify cell-type specific expression patterns within tissues.

  • Translational Fusions: Creating GFP fusions to the full-length protein under its native promoter allows simultaneous visualization of expression patterns and subcellular localization.

When analyzing expression data, researchers should normalize to appropriate controls as described in the search results, considering the use of multiple reference genes for robust normalization .

How does At2g39960 function integrate with cellular stress response pathways?

The integration of At2g39960 with cellular stress response pathways can be examined through several approaches:

  • Expression Analysis Under Stress: Monitor At2g39960 expression changes during various stresses, particularly ER stress conditions induced by agents like tunicamycin or DTT that are known to trigger the unfolded protein response .

  • Genetic Interaction Studies: Create double mutants between At2g39960 and key stress response pathway genes (e.g., bZIP transcription factors involved in UPR) to identify genetic interactions and pathway connections.

  • Proteomics Approaches: Analyze changes in the signal peptidase complex composition and activity under stress conditions.

  • Stress Sensitivity Phenotyping: Compare stress tolerance of At2g39960 mutants to wild-type plants under various conditions, including ER stress, drought, heat, and pathogen challenge.

The signal peptidase complex's role in processing secretory and membrane proteins suggests At2g39960 may be particularly important during stresses that increase demands on the secretory pathway or require significant membrane remodeling .

What statistical approaches are appropriate for analyzing data from At2g39960 expression studies?

For robust statistical analysis of At2g39960 expression data:

  • Normalization Strategy: When At2g39960 itself is the target of study (rather than being used as a reference gene), appropriate reference genes must be selected. The search results indicate genes like EF1α and YLS8 are suitable candidates .

  • Statistical Tests:

    • ANOVA with appropriate post-hoc tests for multi-group comparisons

    • Student's t-test for pairwise comparisons

    • Non-parametric alternatives when data does not meet normality assumptions

  • Technical Replicates: Include at least three technical replicates per biological sample for qPCR analysis.

  • Biological Replicates: A minimum of three biological replicates is necessary, with more recommended for detecting subtle changes.

  • Multiple Testing Correction: When performing genome-wide analyses, correction methods such as Benjamini-Hochberg should be applied to control false discovery rates.

For genome-wide expression studies, specialized approaches like those mentioned in the search results (Tiling arrays) can provide comprehensive transcriptome analysis .

How can researchers integrate proteomics and transcriptomics data for a comprehensive understanding of At2g39960 function?

Integrative analysis of multi-omics data related to At2g39960 requires:

  • Correlation Analysis: Compare At2g39960 transcript levels with protein abundance across conditions to identify potential post-transcriptional regulation.

  • Protein Interaction Networks: Combine transcriptomic data with protein-protein interaction data to build functional networks centered on At2g39960.

  • Pathway Enrichment Analysis: Identify biological processes and pathways enriched among genes/proteins co-regulated with At2g39960.

  • Time-Course Studies: Integrate time-resolved transcriptomics and proteomics data to understand the dynamics of processes involving At2g39960, similar to the developmental studies of storage proteins described in the search results .

  • Data Visualization Tools: Use specialized software for integrative visualization of multi-omics data.

The search results demonstrate successful integrative approaches, such as the combined transcriptional and proteomic profiling of storage protein expression and accumulation in Arabidopsis seeds, which could serve as a methodological template .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.