Recombinant Arabidopsis thaliana Probable transmembrane ascorbate ferrireductase 2 (CYB561B)

Shipped with Ice Packs
In Stock

Description

Protein Overview

CYB561B (UniProt ID: Q9SWS1) belongs to the cytochrome b561 family, characterized by six transmembrane domains and two heme-b centers . In Arabidopsis thaliana, it facilitates trans-membrane electron transfer using ascorbate (ASC) as an electron donor . The recombinant form (1-230 aa) is expressed in E. coli with an N-terminal His tag, yielding >90% purity via SDS-PAGE .

Key Features

PropertyDetails
SpeciesArabidopsis thaliana
Expression SystemE. coli
Molecular Weight~26 kDa (calculated)
Storage Conditions-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) for stability

Domain Architecture

  • Six transmembrane helices with conserved His residues coordinating two heme-b groups .

  • Cytoplasmic and noncytoplasmic ascorbate-binding sites identified via mutagenesis and crystallography .

Critical Residues

  • Cytoplasmic side: Lys81 and Arg150 essential for ASC oxidation .

  • Noncytoplasmic side: His106 and Phe105 critical for ferric-chelate reduction .

  • Mutations (e.g., K81A/R150A or F105W/H106E) abolish electron transfer capacity .

Ascorbate Recycling

CYB561B regenerates ASC by reducing monodehydroascorbate (MDHA) across membranes, maintaining cellular redox balance .

Ferrireductase Activity

  • Reduces Fe³⁺ to Fe²⁺ for transmembrane transport, critical for iron homeostasis .

  • Complements yeast Δfre1Δfre2 mutants in iron-deficient conditions, confirming Fe³⁺-reductase functionality .

Mechanistic Model

  1. Cytoplasmic side: ASC donates electrons, forming MDHA .

  2. Noncytoplasmic side: Electrons reduce Fe³⁺ or MDHA, facilitated by proton gradients .

Spectral Features

  • Oxidized form: Soret peak at 416 nm .

  • Reduced form: Peaks at 428, 531, and 561 nm .

  • Ascorbate titration reveals two reduction phases (K₁ = 0.045 mM, K₂ = 2.34 mM) .

Redox Kinetics

  • Rapid reduction by ASC (complete within 15 s) .

  • Insensitive to NADH, NADPH, or glutathione .

In Vitro Studies

  • Used in proteoliposome assays to characterize ASC-dependent Fe³⁺ reduction .

  • Structural studies resolved at 2.0 Å resolution (PDB: 4EI5) reveal substrate-binding pockets .

Agricultural Relevance

  • Linked to vacuolar iron remobilization via interaction with NRAMP3/4 transporters .

  • Potential target for enhancing iron bioavailability in crops .

Comparative Analysis

CYB561 Family Members

ProteinOrganismLocalizationKey Function
CYB561B (At)ArabidopsisVacuolar membraneIron reduction, ASC recycling
DCytb (Hs)HumanDuodenumDietary iron absorption
LCytb (Mm)MouseLysosomesNeurotransmitter synthesis

Recent Findings

  • Dual substrate specificity: Competes for ASC and ferric chelates depending on cellular context .

  • Pathological links: Human homologs implicated in cancer progression and neurological disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your specifications.
Lead Time
Delivery time may vary based on purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
CYB561B; ACYB-1; CYB-1; CYB561B2; CYBASC2; CYTB561; At5g38630; MBB18.18; Transmembrane ascorbate ferrireductase 2; Cytochrome b561-1; Artb561-2; AtCytb561; Protein b561A.tha4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CYB561B
Target Protein Sequence
MAVPVLGGFPIFMVVRVLGFIIAALVLTWTVHYRGGLALSSDNKDHIFNVHPVMMVIGLI LFNGEAMLAYKSVQGTKNLKKLVHLTLQLTAFILSLIGVWAALKFHIDKGIENFYSLHSW LGLACLFLFAFQWAAGFVTYWYPGGSRNSRASLMPWHVFLGISIYALALVTATTGILEKV TFLQVNQVITRYSTEAMLVNTMGVLILILGGFVILGVVTPVSGKDQVLTQ
Uniprot No.

Target Background

Function
This protein is a two-heme-containing cytochrome that catalyzes ascorbate-dependent transmembrane ferric-chelate reduction (Probable).
Gene References Into Functions
  1. Research has shown that the optical spectra, EPR spectra, and redox potentials of recombinant TCytb are similar to those of the well-characterized bovine chromaffin granule Cyt-b561. PMID: 17376442
Database Links

KEGG: ath:AT5G38630

STRING: 3702.AT5G38630.1

UniGene: At.49099

Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, seedlings, leaves and flowers. Expressed in the L1 layer of the shoot apex, in the epidermis of leaf primordia and young leaves and in vascular bundles. In the differentiation zone of the root, detected in the pericycle and in the epid

Q&A

What is the molecular structure of Arabidopsis thaliana CYB561B?

Arabidopsis thaliana CYB561B belongs to the cytochrome b561 family of transmembrane di-heme proteins. The protein contains six transmembrane (TM) α-helical domains with two pairs of histidine residues arranged on four consecutive TM helices that coordinate two b-type hemes located on each side of the membrane . The central four TM helices constitute the "CYB561-core" which is responsible for intramolecular electron transfer. The Arabidopsis genome contains four genes encoding six-TM CYB561s with approximately 30% sequence identity to the canonical bovine chromaffin granule cytochrome b561 (CGCytb/CYB561A1) .

What are the key functional domains of CYB561B?

The protein contains two critical functional domains: (1) the CYB561-core domain comprising the central four transmembrane helices that coordinate two heme b molecules through four conserved histidine residues, and (2) two distinct substrate binding sites located on the cytoplasmic and luminal sides of the protein . EPR studies of Arabidopsis TCytb/CYB561B1 have definitively shown that the high-potential (HP) heme center is located on the cytosolic side, while the low-potential (LP) heme is positioned on the intra-vesicular side . These domains work together to facilitate transmembrane electron transfer from cytoplasmic ascorbate to the opposite side of the membrane.

What is the subcellular localization of CYB561B in Arabidopsis?

Based on GFP-fusion experiments and Fe3+-reduction assays, the Arabidopsis TCytb/CYB561B1 is localized in the tonoplast (vacuolar membrane) . This localization is functionally significant as it suggests that this CYB561 isoform reduces Fe3+ in the vacuolar lumen, supporting iron transport to the cytoplasm. This is consistent with the general observation that CYB561 proteins are typically found in membranes separating the cytoplasm from acidic compartments .

What expression systems are optimal for recombinant CYB561B production?

Recombinant CYB561 proteins, including those from Arabidopsis, have been successfully expressed in multiple heterologous systems including yeasts (Saccharomyces cerevisiae, Pichia pastoris), insect (Sf9) cells, and Escherichia coli . The selection of an appropriate expression system depends on experimental objectives, with yeast systems often preferred for functional studies due to their eukaryotic membrane structure and post-translational processing capabilities.

What detergents are most effective for solubilizing recombinant CYB561 proteins?

For membrane proteins in the CYB561 family, detergent selection is critical for maintaining structural integrity and function. Studies with the mouse CYB561D1 protein demonstrated that dodecyl-β-D-maltoside (DDM) was the most efficient solubilizing agent among several nonionic detergents tested . This finding likely extends to Arabidopsis CYB561B given the structural similarities within this protein family. The effectiveness of the solubilization can be assessed by measuring the ascorbate-reducible protein content in the solubilized fractions using ascorbate-reduced minus ferricyanide-oxidized difference spectroscopy .

What spectroscopic methods are most informative for characterizing CYB561B?

Multiple spectroscopic techniques provide complementary insights into CYB561B structure and function:

  • Optical absorption spectroscopy: Reveals characteristic split α-bands in the spectrum of ascorbate-reduced CYB561 proteins, confirming the presence of two distinct heme pockets

  • EPR (Electron Paramagnetic Resonance) spectroscopy: Essential for determining the location and environment of heme centers; was crucial in establishing that the HP-heme in Arabidopsis TCytb/CYB561B1 is located on the cytosolic side

  • Circular dichroism (CD) spectroscopy: Useful for investigating electronic interactions between the two heme-b centers

  • Redox titration experiments: Allow determination of the midpoint reduction potentials of individual heme centers

How can the two heme centers in CYB561B be distinguished spectroscopically?

Singular value decomposition analysis of spectroscopic data from Arabidopsis TCytb/CYB561B1 has successfully identified two distinct b-type heme spectra that could be assigned to the two hemes . The property of split α-bands in the absorption spectrum indicates that each heme is located in an anisotropic electrostatic field, resulting from the distribution of charged amino acid residues around the heme pockets . The fine structure of the split α-band varies between CYB561 isoforms due to differences in primary structure, allowing for distinction between different hemes and different isoforms .

What are the ascorbate binding characteristics of CYB561B?

Arabidopsis TCytb/CYB561B1 exhibits two distinct affinity sites for ascorbate interaction . While the exact binding constants for TCytb/CYB561B1 are not explicitly provided in current literature, comparison with other CYB561 proteins suggests approximate values in the range of 0.01 mM (high affinity) and 1 mM (low affinity) . It's important to note that these parameters are not true binding constants but rather characterizations of the interaction between ascorbate and CYB561 that result in the reduction of the high-potential and low-potential hemes .

What is the molecular mechanism of transmembrane electron transfer in CYB561B?

The central function of CYB561B is transmembrane electron transfer (TMET) through sequential reduction and oxidation of the high-potential (HP) and low-potential (LP) hemes . The electron transfer pathway begins with cytoplasmic ascorbate donating electrons to the HP-heme. These electrons are then transferred to the LP-heme, which subsequently reduces monodehydroascorbate (MDHA) or Fe3+ in the trans compartment . For Arabidopsis TCytb/CYB561B1 localized in the tonoplast, the ascorbate-binding (electron acceptor) site is on the cytoplasmic side, enabling the reduction of Fe3+ in the vacuolar lumen . Conserved residues in the transmembrane domains create an electron tunneling pathway that facilitates this process .

What conserved residues are critical for electron transfer in CYB561B?

Several conserved residues play crucial roles in electron transfer:

  • Four conserved histidine residues: Essential for coordinating the two heme b molecules

  • Conserved lysine (K80): In Arabidopsis TCytb/CYB561B1, this residue appears to play a role analogous to the arginine (R72) found in CYB561A members, which is associated with high-affinity ascorbate binding

  • Positively charged residues: Lysine and arginine residues in loop regions between TM helices facilitate interaction with ascorbate and monodehydroascorbate anions

Mutagenesis of K83 in maize CYB561B1 resulted in altered midpoint redox potentials and modified ascorbate-reduction kinetics, demonstrating the functional importance of these conserved residues .

How reliable are current structural models of CYB561B?

While crystal-structure-level 3D atomic information is not yet available for any CYB561 protein , computational 3D atomic resolution models have been calculated for Arabidopsis TCytb/CYB561B1 to support functional analysis . These models are based on homology modeling techniques and are informed by experimental data including spectroscopic measurements, mutagenesis studies, and sequence conservation analysis. The reliability of these models is supported by their ability to explain experimental observations, though they remain theoretical constructs awaiting validation through high-resolution structural determination.

How do mutations in heme-coordinating histidines affect CYB561B function?

Mutagenesis studies have revealed differential effects depending on which heme's coordinating histidines are altered:

  • LP-heme (intra-vesicular side) histidine mutations: In Arabidopsis TCytb/CYB561B1, these mutations resulted in nearly undetectable protein levels, suggesting these residues are critical for proper folding or stability

  • HP-heme (cytosolic side) histidine mutations: These had minimal effect on protein expression but significantly altered ascorbate-reduction kinetics and reduced heme content

What is the proposed physiological role of CYB561B in Arabidopsis?

Arabidopsis TCytb/CYB561B1 appears to play a significant role in iron homeostasis . Its tonoplast localization and Fe3+-reductase activity suggest it functions in reducing vacuolar Fe3+ to Fe2+, facilitating iron transport from the vacuole to the cytoplasm . This is supported by the identification of vacuolar Fe2+-transporters (NRAMP3, NRAMP4) that may act in conjunction with TCytb/CYB561B1 . Plant vacuoles likely serve as iron storage compartments for remobilization when metabolic needs exceed supply, and the ascorbate-dependent CYB561-mediated Fe3+-reductase activity complements the NADH-dependent activity of FRO proteins in iron metabolism .

Is there functional redundancy among CYB561 isoforms in Arabidopsis?

Despite the presence of multiple CYB561 isoforms in Arabidopsis, their expression patterns suggest non-redundant functions. CYB561 isoforms show some overlapping organ distribution patterns, but they are not identical and occur in different membrane types . In a recently isolated Arabidopsis homozygous knockout of TCytb/CYB561B1, transcription of at least three other CYB561 isoforms was not enhanced, supporting the notion that CYB561 isoform expression is not redundant . This implies that each isoform likely performs specialized functions, potentially in different tissues, developmental stages, or in response to different environmental conditions.

How can CYB561B activity be quantified in experimental systems?

The Fe3+-reductase activity of CYB561B can be measured through complementation studies in Fe3+-reductase-deficient yeast lines (Δfre1Δfre2) . Reduction of extracellular Fe3+-chelates in transformed yeast cells expressing Arabidopsis TCytb/CYB561B1 has been successfully demonstrated . Additionally, ascorbate-dependent electron transfer can be monitored spectroscopically by measuring the ascorbate-reduced minus ferricyanide-oxidized difference spectrum . These approaches provide quantitative insights into CYB561B functionality in various experimental contexts.

How does the pH gradient affect CYB561B activity?

CYB561 proteins, including CYB561B, are typically found in membranes separating the cytoplasm from acidic compartments . This transmembrane pH gradient, maintained by H+-transporting ATPases, is likely essential for optimal CYB561 function . While the precise mechanism by which the pH gradient affects electron transfer is not fully elucidated, it may influence the redox potentials of the hemes, the protonation states of key residues involved in electron transfer, or the availability of substrate in appropriate redox states. This represents an important area for future research into CYB561B function.

What structural data would advance understanding of CYB561B function?

High-resolution structural determination of CYB561B through X-ray crystallography or cryo-electron microscopy would significantly advance understanding of this protein family. Current models are computational predictions , and atomic-level structural data would clarify the precise arrangement of transmembrane helices, heme coordination, and substrate binding sites. This would facilitate structure-based design of experiments to probe electron transfer mechanisms and could potentially enable rational modification of CYB561B properties for biotechnological applications.

How does CYB561B coordinate with other iron metabolism proteins?

While research has identified potential functional relationships between Arabidopsis TCytb/CYB561B1 and vacuolar Fe2+-transporters (NRAMP3, NRAMP4) , the molecular details of this coordination remain to be fully characterized. Further investigation into potential protein-protein interactions, co-regulation mechanisms, and the dynamics of iron mobilization from vacuolar stores would enhance understanding of CYB561B's role in plant iron homeostasis. Such studies could employ techniques like co-immunoprecipitation, split-ubiquitin yeast two-hybrid assays, or in vivo FRET analysis to identify protein interaction partners.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.