Recombinant Arabidopsis thaliana Probable transmembrane ascorbate ferrireductase 3 (CYB561C)

Shipped with Ice Packs
In Stock

Description

Biochemical Function

CYB561C functions as a trans-membrane electron transporter, linking cytoplasmic ASC oxidation to extracellular/luminal Fe³⁺ reduction. Key activities include:

Ascorbate Ferrireductase Activity

  • Catalyzes electron transfer from ASC to Fe³⁺-chelates (e.g., Fe³⁺-citrate) via its heme centers .

  • Kinetic studies show biphasic ASC reduction, with high-affinity (Km=0.0160.053mMK_m = 0.016–0.053 \, \text{mM}) and low-affinity (Km=0.3941.24mMK_m = 0.394–1.24 \, \text{mM}) binding sites .

Iron Homeostasis

  • Facilitates vacuolar iron remobilization by reducing stored Fe³⁺ to Fe²⁺, which is exported to the cytoplasm via NRAMP transporters .

Mechanistic Insights

Electron transfer proceeds through a conserved pathway:

  1. Cytoplasmic ASC oxidation: ASC binds near Lys81 (A. thaliana numbering), donating an electron to the HP heme and releasing MDHA and a proton .

  2. Intramolecular electron transfer: Electrons move from HP to LP heme via the CYB561-core domain .

  3. Luminal Fe³⁺ reduction: LP heme reduces Fe³⁺-chelates or MDHA, regenerating ASC .

Key Residues for Activity

ResidueRole
His106Coordinates LP heme; critical for Fe³⁺ reduction .
Lys81Stabilizes ASC binding on the cytoplasmic side .
Arg72 (homologs)Conserved in CYB561A subfamily; essential for high-affinity ASC binding .

Recombinant Expression and Purification

CYB561C is expressed in E. coli as a His-tagged protein and purified under denaturing conditions due to its hydrophobic nature .

ParameterSpecification
Expression SystemE. coli
Purity>90% (SDS-PAGE) .
StorageLyophilized in Tris/PBS buffer (pH 8.0) with 6% trehalose; stable at -80°C .
ReconstitutionRequires addition of 5–50% glycerol to prevent aggregation .

Comparative Analysis with Other CYB561 Proteins

FeatureCYB561C (A. thaliana)CYB561A1 (Bovine)CYB561D1 (Mouse)
LocalizationTonoplast Chromaffin granule Plasma membrane
Redox Potential (mV)HP: +160; LP: +20 HP: +171; LP: +81 HP: +150; LP: +60
Primary SubstrateFe³⁺-chelates, MDHA MDHA ASC/Fe³⁺-chelates

Research Applications

  • Iron Metabolism Studies: Used to elucidate plant iron storage/remobilization mechanisms .

  • Redox Biochemistry: Serves as a model for trans-membrane electron transport in eukaryotes .

  • Biotechnological Tool: Potential use in bioengineered systems for ASC recycling or Fe²⁺ delivery .

Challenges and Future Directions

  • Structural Resolution: No full-length crystal structure exists; homology models rely on bovine CYB561A1 .

  • In Vivo Role: While in vitro Fe³⁺-reductase activity is confirmed, its interaction with plant NRAMP transporters remains understudied .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
As a standard practice, all our proteins are shipped with normal blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential to minimize freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CYB561C; At1g14730; F10B6.13; Probable transmembrane ascorbate ferrireductase 3; Artb561-3; Protein b561A.tha14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CYB561C
Target Protein Sequence
MNLSGDRTTLKRHSSLSTLVAHFFGILAVVLMLIWLLHYREGIEYGSDNPLKVLNVHPFL MYCGFLFLVGQAMMTYKTAYASHQVQKMVHGGLHLIGLVLGIVGICAAFRFHDKVNLKDM VSLHSWIGLTTFILLGVQWLFGAFTFLAPQSSSGTRTRMMPWHVLGGRALLYMGIVAALT GLMQRATMLGQSTNAESRLINFLGLAILLFGVSVDFSVALGRYN
Uniprot No.

Target Background

Function
This protein is a two-heme-containing cytochrome that potentially catalyzes ascorbate-dependent trans-membrane ferric-chelate reduction.
Database Links

KEGG: ath:AT1G14730

UniGene: At.41956

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of CYB561C and how does it compare to other CYB561 family members?

CYB561C belongs to the cytochrome b561 family of transmembrane proteins characterized by six transmembrane α-helices. The central four helices constitute the "CYB561-core" domain, which coordinates two heme b molecules via four highly conserved histidine residues. This core domain is responsible for intramolecular electron transfer across the membrane. Like other CYB561 family members, CYB561C shares approximately 30% sequence identity with the canonical CGCytb/CYB561A1 . The protein's structure includes distinct cytosolic and luminal domains with specific functional roles in electron transfer.

What are the primary physiological functions of CYB561C in Arabidopsis thaliana?

CYB561C functions as a transmembrane electron transport protein with dual enzymatic activities:

  • Monodehydroascorbate reductase activity - regenerating ascorbate from monodehydroascorbate

  • Ferric reductase activity - reducing Fe³⁺ to Fe²⁺ to facilitate iron transport

These activities support several physiological processes in Arabidopsis:

  • Front-line (apoplastic) defense against oxidative stress

  • Iron uptake and homeostasis

  • Ascorbate regeneration in various tissues

  • Cell wall modifications

The specific subcellular localization of CYB561C influences its precise physiological role, potentially in vacuolar or plasma membrane contexts similar to other characterized CYB561 proteins.

How does CYB561C participate in iron homeostasis in plants?

CYB561C contributes to iron homeostasis through its Fe³⁺-reductase activity. Similar to other CYB561 family members, it likely reduces Fe³⁺ to Fe²⁺ using electrons derived from ascorbate. This reduction is critical for iron transport across membranes, as Fe²⁺ is the preferred form for transmembrane iron transporters.

In Arabidopsis, the CYB561 family member TCytb/CYB561B1 localizes to the tonoplast and may reduce Fe³⁺ in the vacuolar lumen to support transport to the cytoplasm. This process works in conjunction with vacuolar Fe²⁺-transporters like NRAMP3 and NRAMP4 . CYB561C likely participates in a similar process depending on its subcellular localization, complementing the NADH-dependent activity of FRO proteins in the plant iron acquisition system.

What are the recommended protocols for heterologous expression and purification of recombinant CYB561C?

Recommended Expression System Protocol:

  • Vector Construction:

    • Clone the full-length CYB561C coding sequence from Arabidopsis cDNA into an expression vector with a suitable affinity tag (His₆ or FLAG)

    • Include a TEV protease cleavage site for tag removal if necessary

  • Expression System Selection:

    • For functional studies: Yeast expression (e.g., Saccharomyces cerevisiae Δfre1Δfre2 strains for complementation assays)

    • For structural studies: Insect cell expression (e.g., Sf9 cells) using baculovirus system

  • Membrane Protein Solubilization:

    • Harvest cells and disrupt using mechanical methods

    • Isolate membrane fraction via ultracentrifugation

    • Solubilize membranes using mild detergents (0.5-1% n-dodecyl-β-D-maltoside or digitonin)

  • Purification Steps:

    • Affinity chromatography using tag-specific resin

    • Size exclusion chromatography to remove aggregates

    • Confirm protein integrity via SDS-PAGE and Western blotting with anti-CYB561 antibodies

This approach is based on successful purification strategies used for related CYB561 family members, including the tonoplast-localized TCytb/CYB561B1 from Arabidopsis .

What methods can be used to accurately measure CYB561C expression levels in plant tissues?

Quantitative Analysis Protocol:

  • RNA Analysis:

    • Total RNA extraction using commercially available kits (e.g., Maxwell® RSC plant RNA kit)

    • First-strand cDNA synthesis (e.g., using iScript™ cDNA Synthesis Kit)

    • Quantitative real-time PCR using SYBR Green-based detection

    • Normalize expression against reference genes such as ACTIN2 (At3g18780)

    • Calculate relative expression using the 2^(-ΔΔCt) method

  • Protein Analysis:

    • Total protein extraction from plant tissues using appropriate buffers

    • Membrane protein enrichment via ultracentrifugation

    • Western blot analysis using specific antibodies against CYB561C

    • Quantification using densitometry with appropriate loading controls

  • Tissue-Specific Expression:

    • For spatial expression patterns, generate promoter:GUS or promoter:GFP reporter lines

    • Perform histochemical GUS staining or fluorescence microscopy

These methods have been successfully applied to study the expression of various proteins in Arabidopsis, including other CYB561 family members and related proteins .

How can I assess CYB561C knockout effects in Arabidopsis?

CYB561C Knockout Assessment Protocol:

  • Generation of Knockout Lines:

    • CRISPR/Cas9-mediated gene editing targeting conserved regions

    • T-DNA insertion mutant identification from publicly available collections

    • Verification of knockout by RT-PCR and Western blot

  • Phenotypic Characterization:

    • Growth metrics: Measure rosette diameter, root length, and fresh weight under control and stress conditions

    • Iron content: Perform inductively coupled plasma mass spectrometry (ICP-MS) analysis of tissues

    • Ascorbate levels: Measure reduced and oxidized ascorbate pools

  • Stress Response Assays:

    • Heavy metal stress: Cultivate plants on media containing varying levels of heavy metals (e.g., lead or iron)

    • Oxidative stress: Expose plants to paraquat, hydrogen peroxide, or high light conditions

    • Document phenotypic differences between knockout and wild-type plants

  • Complementation Studies:

    • Transform knockout lines with functional CYB561C to verify phenotype rescue

    • Analyze transcript and protein levels in complemented lines

Similar approaches have been used to study gene function in Arabidopsis, including growth assessments in response to heavy metal stress and gene expression analysis .

What is the electron transfer mechanism in CYB561C and how do specific amino acid residues contribute to it?

The electron transfer mechanism in CYB561C involves sequential reduction and oxidation of two heme b molecules coordinated by four conserved histidine residues in the transmembrane domain. Based on studies of related CYB561 proteins:

  • Electron Flow Pathway:

    • Cytosolic ascorbate donates an electron to the high-potential (HP) heme

    • Electron transfers intramolecularly to the low-potential (LP) heme

    • LP heme reduces the substrate (Fe³⁺ or monodehydroascorbate) on the opposite side of the membrane

  • Critical Residues:

    • Four conserved histidines coordinate the two heme groups

    • Mutations in LP-heme coordinating histidines typically result in undetectable protein levels

    • Mutations in HP-heme coordinating histidines affect ascorbate reduction kinetics and heme content

    • Conserved lysine residues (equivalent to K83 in maize CYB561B1) influence midpoint redox potentials and ascorbate reduction kinetics

  • Domain-Specific Functions:

    • Loop regions on the intra-vesicular side are crucial for transmembrane Fe³⁺-reductase activity

    • Cytoplasmic domains contain ascorbate binding sites that influence electron acceptance

These mechanistic insights derive from detailed mutagenesis studies of related CYB561 family members and suggest a conserved structure-function relationship likely applicable to CYB561C .

How does CYB561C expression respond to various environmental stresses in Arabidopsis?

CYB561C expression in Arabidopsis is dynamically regulated by multiple environmental factors:

Stress-Response Patterns:

Stress ConditionExpression ChangeCellular ResponsePhysiological Significance
Iron deficiencyUpregulationEnhanced Fe³⁺ reductionImproved iron acquisition
Heavy metal exposureDifferential regulationAltered reduction capacityPotential detoxification role
Oxidative stressUpregulationIncreased ascorbate regenerationImproved ROS scavenging
Drought/salinityVaries by tissueModulated electron transportStress adaptation

This regulation likely involves intricate signaling networks similar to those controlling related genes in Arabidopsis under varied environmental conditions. For instance, expression analysis of heavy metal response genes in Arabidopsis shows complex regulation patterns dependent on specific stressors and genetic backgrounds .

Experimental approaches to study these responses include:

  • Quantitative PCR analysis under controlled stress conditions

  • Promoter-reporter fusion studies to visualize expression patterns

  • Transcriptome analysis to identify co-regulated genes

What is the relationship between CYB561C and other iron homeostasis proteins in Arabidopsis?

CYB561C functions within a complex network of iron homeostasis proteins in Arabidopsis:

  • Complementary Activities:

    • CYB561C likely provides ASC-dependent Fe³⁺-reductase activity that complements the NADH-dependent activity of FRO proteins

    • Operates in coordination with specific iron transporters based on subcellular localization

  • Subcellular Cooperation:

    • If tonoplast-localized (like TCytb/CYB561B1), cooperates with vacuolar Fe²⁺-transporters NRAMP3 and NRAMP4

    • If plasma membrane-localized, may work with IRT1 Fe²⁺-transporter

    • Functions downstream of regulatory proteins like FIT and upstream of iron storage proteins

  • Regulatory Interactions:

    • Likely regulated by iron-responsive transcription factors

    • May participate in feedback loops involving iron sensing and signaling

    • Expression patterns potentially overlap with other iron deficiency response genes

Experimental evidence from related CYB561 proteins suggests both common and distinct roles in iron metabolism, with specific functions determined by subcellular localization and tissue expression patterns .

How can CYB561C research contribute to improving plant resilience to heavy metal stress?

Research on CYB561C offers several avenues for enhancing plant resilience to heavy metal stress:

  • Mechanisms of Heavy Metal Tolerance:

    • CYB561C may reduce toxic heavy metals, affecting their mobility and toxicity

    • Understanding its role could reveal detoxification pathways

    • Research into natural variation in CYB561C expression among Arabidopsis accessions provides insights into adaptive mechanisms

  • Biofortification Applications:

    • Modifying CYB561C expression could enhance iron content in edible plant tissues

    • Potentially improve nutritional quality of crops grown in iron-limited soils

    • Balance iron acquisition with heavy metal exclusion mechanisms

  • Phytoremediation Strategies:

    • Engineered expression of CYB561C might enhance heavy metal accumulation capacity

    • Could improve effectiveness of plants used for environmental cleanup

    • Integration with other metal transport systems may optimize metal extraction

Studies examining differential lead accumulation in natural Arabidopsis accessions demonstrate how genetic variation influences heavy metal responses, providing a foundation for similar investigations with CYB561C .

What techniques are most effective for studying CYB561C subcellular localization and trafficking?

Recommended Localization Analysis Methods:

  • Fluorescent Protein Fusion Approaches:

    • Generate N- and C-terminal GFP/YFP fusions with CYB561C

    • Express in Arabidopsis protoplasts or stable transgenic plants

    • Co-localize with established membrane compartment markers

    • Use confocal microscopy for high-resolution imaging

  • Biochemical Fractionation:

    • Perform careful subcellular fractionation of plant tissues

    • Isolate membrane fractions (plasma membrane, tonoplast, ER, etc.)

    • Detect CYB561C using specific antibodies via Western blot

    • Compare distribution with known membrane marker proteins

  • Advanced Imaging Techniques:

    • FRET analysis for protein-protein interactions

    • FRAP (Fluorescence Recovery After Photobleaching) for mobility assessment

    • Super-resolution microscopy for detailed membrane organization

    • Live-cell imaging to track trafficking dynamics

These approaches have been successfully employed to determine the subcellular localization of TCytb/CYB561B1 to the tonoplast in Arabidopsis , and similar methods would be applicable to CYB561C.

What insights does CYB561C research provide for understanding comparable proteins in human disease contexts?

CYB561C research in Arabidopsis offers valuable comparative insights for human CYB561 proteins implicated in disease:

  • Conserved Structural Elements:

    • The six-transmembrane architecture and di-heme coordination are conserved between plant and human CYB561 proteins

    • Fundamental electron transfer mechanisms appear similar across species

    • Structure-function relationships identified in plant CYB561C inform human protein studies

  • Cancer Biology Connections:

    • Human CYB561 is highly expressed in various tumors, particularly breast cancer

    • CYB561 knockout inhibits breast cancer cell proliferation

    • Understanding plant CYB561C regulation may suggest mechanisms relevant to human cancer contexts

  • Potential Therapeutic Applications:

    • Plant studies of CYB561C can inform drug discovery targeting human CYB561

    • Several compounds (Urethane, Atrazine, Propylthiouracil, Acrylamide, Doxorubicin, Permethrin, Testosterone) have been identified as potential interactors with CYB561

    • Structure-based insights from plant proteins may guide rational drug design

The connection between plant and human CYB561 proteins highlights the value of basic research in model organisms for understanding human disease mechanisms and developing potential therapeutic approaches .

What are common challenges in studying membrane proteins like CYB561C and how can they be overcome?

Common Challenges and Solutions:

ChallengeSolution ApproachTechnical Considerations
Low expression levelsOptimize codon usage; use strong tissue-specific promotersBalance expression with proper folding and targeting
Protein instabilityInclude protease inhibitors; optimize buffer conditionsTest multiple pH values and salt concentrations
Difficult solubilizationScreen detergent panel; use nanodiscs or amphipolsStart with milder detergents (DDM, digitonin)
Non-specific antibodiesGenerate peptide-specific antibodies to unique regionsValidate specificity with knockout controls
Maintaining redox stateInclude appropriate reducing agents; minimize oxidationConsider anaerobic handling for sensitive experiments

These approaches have proven effective when working with challenging membrane proteins, including members of the CYB561 family in various experimental systems .

How can I accurately measure the Fe³⁺-reductase activity of recombinant CYB561C?

Fe³⁺-Reductase Activity Assay Protocol:

  • Yeast Complementation System:

    • Express CYB561C in Δfre1Δfre2 Fe³⁺-reductase-deficient yeast strains

    • Plate transformants on iron-limited media

    • Compare growth with positive and negative controls

    • Quantify rescue of growth phenotype

  • Direct Enzymatic Activity Measurement:

    • Prepare proteoliposomes with purified recombinant CYB561C

    • Load liposomes with ascorbate

    • Add Fe³⁺-chelates (e.g., Fe³⁺-citrate, Fe³⁺-EDTA)

    • Measure Fe²⁺ formation using colorimetric assays with ferrozine

    • Calculate activity rates under varying substrate concentrations

  • Cellular Assays:

    • Transform cells with CYB561C expression constructs

    • Measure reduction of extracellular Fe³⁺-chelates

    • Use controls to distinguish CYB561C-specific activity from endogenous activities

    • Assess impact of ascorbate availability on reduction rates

These methods have been successfully applied to other CYB561 family members, demonstrating their Fe³⁺-reductase activity in both in vitro and heterologous expression systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.