Recombinant Arabidopsis thaliana Probable ubiquitin-conjugating enzyme E2 33 (UBC33)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Arabidopsis thaliana Probable Ubiquitin-Conjugating Enzyme E2 33 (UBC33)

Recombinant Arabidopsis thaliana Probable Ubiquitin-Conjugating Enzyme E2 33, commonly referred to as UBC33, is a specific enzyme that participates in the ubiquitin-proteasome system (UPS) in plants . The UPS is crucial for regulating protein turnover, signaling pathways, and maintaining cellular homeostasis in eukaryotic cells .

UBC33 is an E2 ubiquitin-conjugating enzyme, which works in conjunction with E1 ubiquitin-activating enzymes and E3 ubiquitin ligases to facilitate the ubiquitination of target proteins . Ubiquitination involves attaching ubiquitin, a small regulatory protein, to a substrate protein, thereby marking it for degradation or altering its function .

Functional Aspects and Significance

  1. Ubiquitin-Conjugating Activity UBC33's primary function involves catalyzing the transfer of ubiquitin to target proteins . This enzymatic activity is central to its role in the ubiquitin-proteasome system.

  2. Interaction with E1 and E3 Enzymes UBC33 interacts with E1 ubiquitin-activating enzymes and E3 ubiquitin ligases to form functional complexes . These interactions dictate the specificity and efficiency of ubiquitination.

  3. Substrate Specificity UBC33 likely exhibits substrate specificity, targeting particular proteins for ubiquitination based on specific signals or cellular conditions .

  4. Role in ER-Associated Protein Degradation (ERAD) UBC33, along with UBC32 and UBC34, is essential for ERAD, which is vital for plant innate immunity and ER stress tolerance . Loss of function in UBC32, UBC33, and UBC34 does not affect flg22 and elf18-triggered suppression of seedling growth but results in alteration of ER stress response, which likely contribute to the diminished plant immunity in the mutants .

  5. Involvement in Plant Immunity UBC33 is involved in plant defense responses, potentially through its role in ERAD and protein turnover related to immune signaling .

  6. Regulation of Stress Responses UBC33 may participate in plant stress responses, such as those induced by endoplasmic reticulum (ER) stress or other environmental factors .

  7. Impact on Plant Development By influencing protein turnover and signaling, UBC33 can affect various aspects of plant development, including growth, differentiation, and reproduction .

Research Findings

Research AreaFindings
ERADUBC33, along with UBC32 and UBC34, is shown to be essential for ERAD and plant innate immunity .
Plant ImmunityUBC32, UBC33 and UBC34 are essential for host immunity, suggesting DUAS may be conserved in many plants . Loss of function in UBC32, UBC33 and UBC34 does not affect flg22 and elf18-triggered suppression of seedling growth but results in alteration of ER stress response, which likely contribute to the diminished plant immunity in the mutants .
ER Stress ResponseThe AtUBC32 and AtUBC33/34 appear to play differential roles in ER stress response, suggesting complexity in the modulation of plant immunity by the E1–group IV E2 triplet module .
Genetic InteractionsStudies on NF-Y transcription factors in Arabidopsis thaliana have shown the importance of subunit interactions . Such research provides a framework to explore UBC33 interactions and their functional consequences.

Experimental Methods to Study UBC33

  1. Recombinant Protein Expression and Purification: Express UBC33 in a suitable expression system (E. coli) and purify it using affinity chromatography .

  2. Ubiquitination Assays: Perform in vitro ubiquitination assays to assess UBC33 activity, typically involving E1 enzyme, ubiquitin, and a target substrate .

  3. Protein Interaction Studies: Use techniques such as yeast two-hybrid, co-immunoprecipitation, or surface plasmon resonance to identify and validate UBC33-interacting proteins .

  4. Structural Analysis: Employ X-ray crystallography or NMR spectroscopy to determine the three-dimensional structure of UBC33, providing insights into its function and interactions2.

  5. Mutational Analysis: Generate UBC33 mutants to identify critical residues for its activity and interactions, and assess the impact of these mutations in vivo .

  6. Plant Phenotyping: Analyze Arabidopsis thaliana plants with altered UBC33 expression (knockouts, overexpressors) to assess the impact on plant development, stress responses, and immunity .

  7. Transcriptomics and Proteomics: Use transcriptomic and proteomic approaches to identify changes in gene expression and protein abundance in response to altered UBC33 function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
UBC33; At5g50430; MXI22.15; Probable ubiquitin-conjugating enzyme E2 33; E2 ubiquitin-conjugating enzyme 33; Ubiquitin carrier protein 33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
UBC33
Target Protein Sequence
MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF PPEYPYKPPGITMTTPNGRFVTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDNSP TTGSVNTSVAEKQRLAKSSLAFNCKSVTFRKLFPEYVEKYSQQQVAEEEAATQQTTTSEN QDFPQKDNAKVESEKSVGLKKESIQEVGLKERRRNKKEALPGWIVLLLVSIVGVVMALPL LQL
Uniprot No.

Target Background

Function

This protein accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.

Database Links

KEGG: ath:AT5G50430

STRING: 3702.AT5G50430.1

UniGene: At.6859

Protein Families
Ubiquitin-conjugating enzyme family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is UBC33 and what is its basic function in Arabidopsis thaliana?

UBC33 (Ubiquitin-conjugating enzyme E2 33) is a probable ubiquitin-conjugating enzyme (EC 6.3.2.19) that functions within the ubiquitin-proteasome system (UPS) in Arabidopsis thaliana. It is also known as Ubiquitin carrier protein 33 and is encoded by the gene associated with UniProt number Q9FK29 . UBC33 operates as an E2 enzyme within the ubiquitylation cascade, accepting activated ubiquitin from E1 enzymes and facilitating its transfer to target proteins in conjunction with E3 ligases.

The ubiquitylation process is central to protein degradation in plants, with UBC33 playing a specific role in this pathway. The process begins when ubiquitin is activated by E1 in an ATP-dependent manner, then transferred to E2 enzymes like UBC33, which work with E3 ligases to attach ubiquitin to target proteins, marking them for degradation via the 26S proteasome . This system is essential for protein quality control and cellular signaling in plants.

UBC33 belongs to a functionally related triplet of E2 enzymes (UBC32/33/34) that have specialized roles in endoplasmic reticulum-associated degradation (ERAD) and plant immunity signaling pathways . These E2 enzymes have evolved to perform complementary yet distinct functions within the plant proteolytic system.

How does UBC33 differ structurally and functionally from other E2 enzymes in Arabidopsis?

UBC33 shares significant structural homology with its close relatives UBC32 and UBC34, forming a functional triplet within the Arabidopsis E2 enzyme family. The structural conservation extends to the catalytic core domain typical of E2 enzymes, which contains the active site cysteine residue that forms a thioester bond with ubiquitin.

Despite these similarities, UBC33 has distinct functional characteristics. Experimental evidence indicates that UBC33 and its triplet partners (UBC32/33/34) are differentially charged by Arabidopsis E1 enzymes, suggesting unique interactions within the ubiquitylation cascade . This differential charging pattern likely contributes to the specialized roles of these E2 enzymes in specific cellular processes.

Functionally, while UBC33 shares overlapping roles with UBC32 and UBC34 in ERAD and immunity, there appear to be subtle differences in their contributions to ER stress responses. Research indicates that "UBC32 and UBC33/34 appear to play differential roles in ER stress response," highlighting functional specialization within this closely related group . This specialization likely enables fine-tuned regulation of proteolysis in response to different cellular stresses and developmental signals.

What are the optimal storage and handling conditions for recombinant UBC33 protein?

For optimal results with recombinant UBC33 protein, researchers should adhere to specific storage and handling protocols that maintain protein stability and activity. The shelf life of recombinant UBC33 is influenced by multiple factors including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself .

For long-term storage, lyophilized forms of UBC33 can maintain stability for approximately 12 months when stored at -20°C to -80°C, while liquid preparations typically remain stable for about 6 months under the same conditions . To prevent degradation through freeze-thaw cycles, it is recommended to prepare working aliquots that can be stored at 4°C for up to one week, as repeated freezing and thawing significantly reduces protein integrity and activity .

When reconstituting lyophilized UBC33, researchers should first centrifuge the vial briefly to collect the contents at the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage of reconstituted protein, addition of glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) before aliquoting and storing at -20°C/-80°C helps maintain protein stability .

What experimental approaches are most effective for studying UBC33 function in plant immunity?

Investigating UBC33's role in plant immunity requires a multi-faceted approach combining genetic, biochemical, and phenotypic analyses. The following methodological framework has proven effective:

  • Genetic manipulation strategies: Generation of UBC33 knockout/knockdown lines using T-DNA insertion mutants or CRISPR-Cas9 gene editing, complemented by overexpression lines, provides the foundation for functional studies. For more refined analysis, researchers should consider creating double or triple mutants with UBC32 and UBC34 to address functional redundancy within this triplet .

  • Pathogen challenge assays: Exposing wild-type and UBC33-modified plants to various pathogens (bacterial, fungal, and viral) allows for quantitative assessment of immunity phenotypes. Key metrics include bacterial growth curves, lesion size measurements, and disease symptom scoring over time.

  • Molecular immunity markers: Monitoring the expression of pathogenesis-related (PR) genes, MAP kinase activation, and ROS production provides insights into specific defense pathway alterations resulting from UBC33 modification.

  • Biochemical activity assays: In vitro ubiquitylation assays using purified components (E1, UBC33, relevant E3 ligases, and potential substrates) enable direct assessment of UBC33's enzymatic function. Comparing the charging efficiency of UBC33 by different E1 enzymes can reveal its activation preferences within the ubiquitylation cascade .

  • Protein-protein interaction studies: Techniques like yeast two-hybrid, co-immunoprecipitation, and bimolecular fluorescence complementation help identify UBC33's interaction partners, including E3 ligases and potential substrates involved in immunity.

Research has demonstrated that loss of function in the UBC32/33/34 triplet diminishes plant immunity without affecting certain PAMP-triggered responses (flg22 and elf18-triggered inhibition of seedling growth), suggesting their role in specific aspects of the immune response . Investigating the relationship between altered ER stress tolerance in UBC33 mutants and compromised immunity provides a valuable research direction.

How can researchers effectively analyze the differential charging of UBC33 by E1 enzymes?

Analyzing the differential charging of UBC33 by E1 enzymes requires specialized biochemical techniques that can detect the formation of thioester linkages between ubiquitin, E1, and UBC33. A comprehensive methodological approach includes:

  • In vitro thioester formation assays: Reconstituting the ubiquitin charging reaction with purified components (ubiquitin, ATP, different E1 enzymes, and UBC33) allows for direct comparison of charging efficiency. Reactions are typically performed in the presence of ATP and terminated by addition of non-reducing or reducing sample buffers to preserve or cleave thioester bonds, respectively.

  • Comparative E1 panel analysis: Testing UBC33 charging with multiple plant E1 enzymes under standardized conditions provides insight into E1 preference. Research has shown that Arabidopsis UBC33 is differentially charged by its E1s, suggesting a specialized connectivity within the ubiquitylation cascade .

  • Kinetic measurements: Determining the rate constants for E1-mediated charging of UBC33 using stopped-flow techniques or time-course experiments provides quantitative data on charging efficiency and preference.

  • Mass spectrometry analysis: Using mass spectrometry to detect ubiquitin-UBC33 conjugates enables precise identification and quantification of the charged species formed with different E1 enzymes.

  • Structural studies: Crystallography or cryo-EM analysis of E1-UBC33 complexes can reveal the structural basis for differential charging, identifying key interface residues that determine specificity.

To validate these findings in a cellular context, researchers can complement in vitro studies with in vivo approaches such as proximity-based labeling techniques or fluorescence resonance energy transfer (FRET) to detect E1-UBC33 interactions in plant cells. This combined approach provides a comprehensive understanding of how UBC33 functions within the plant's dual ubiquitin-activating system (DUAS).

What methods are recommended for purifying active recombinant UBC33 for in vitro studies?

Purifying active recombinant UBC33 requires careful consideration of expression systems, purification strategies, and quality control measures. The following methodological approach is recommended:

  • Expression system selection: E. coli-based expression systems have proven effective for producing recombinant UBC33, as evidenced by commercially available preparations . BL21(DE3) or similar strains with reduced protease activity are preferable for maximizing yield and minimizing degradation.

  • Construct design considerations: Including an affinity tag (His6, GST, or MBP) facilitates purification while considering the potential impact on enzyme activity. For structural or interaction studies where tags might interfere, constructs with cleavable tags should be employed. The tag type is typically determined during the manufacturing process based on the specific experimental requirements .

  • Optimized purification protocol:

    • Initial capture using affinity chromatography (Ni-NTA for His-tagged proteins)

    • Tag cleavage (if necessary) using precise protease digestion

    • Secondary purification via ion exchange chromatography to remove contaminants

    • Final polishing using size exclusion chromatography to ensure homogeneity

    • Buffer optimization to maintain stability (typically phosphate or Tris-based buffers with reducing agents)

  • Activity verification: Performing ubiquitin charging assays with purified E1 and UBC33 to confirm that the purified enzyme forms the expected thioester intermediate with ubiquitin. This functional validation is essential before proceeding to more complex experiments.

  • Quality control metrics: The purity of recombinant UBC33 should exceed 85% as assessed by SDS-PAGE . Additional quality controls include mass spectrometry verification, dynamic light scattering to assess homogeneity, and thermal shift assays to evaluate stability.

For long-term storage, adding glycerol to a final concentration of 5-50% before aliquoting and freezing at -20°C/-80°C helps maintain enzyme activity . When designing experiments, researchers should be aware that recombinant UBC33 may represent a partial length of the native protein, which could affect certain protein-protein interactions or regulatory mechanisms .

How does UBC33 contribute to ER stress tolerance and how can this be experimentally investigated?

UBC33, together with UBC32 and UBC34, plays a crucial role in endoplasmic reticulum-associated degradation (ERAD), which is essential for ER stress tolerance in plants. Research has shown that alteration of ER stress response in UBC32/33/34 mutants likely contributes to diminished plant immunity . Investigating this relationship requires sophisticated experimental approaches:

  • ER stress induction assays: Exposing wild-type and UBC33 mutant plants to ER stress inducers such as tunicamycin, dithiothreitol (DTT), or thapsigargin allows for comparative analysis of stress responses. Key parameters to measure include:

    • Survival rates under various concentrations of ER stressors

    • Root growth inhibition assays to quantify sensitivity

    • Chlorophyll content as an indicator of physiological impact

  • Unfolded Protein Response (UPR) monitoring: The UPR is activated in response to ER stress, and its intensity can be measured through:

    • qRT-PCR analysis of UPR marker genes (BiP, PDI, CNX)

    • Western blot detection of UPR-related proteins

    • Analysis of bZIP transcription factor splicing (particularly bZIP60)

    • GUS reporter constructs driven by UPR-responsive promoters

  • Proteostasis analysis: Direct measurement of ERAD efficiency can be achieved by:

    • Pulse-chase experiments with known ERAD substrates to measure degradation kinetics

    • Analysis of ubiquitylated protein accumulation under ER stress conditions

    • Fluorescent timer fusion proteins to monitor substrate turnover in real-time

  • Comparative phenotyping: Detailed phenotypic comparison of UBC32, UBC33, and UBC34 single, double, and triple mutants under ER stress conditions can reveal their differential contributions. Research indicates that "AtUBC32 and AtUBC33/34 appear to play differential roles in ER stress response," suggesting functional specialization within this triplet .

  • Integration with immunity pathways: Combining ER stress treatments with pathogen challenges in various genetic backgrounds can establish causation between ER stress tolerance and immunity. Experimental designs should include:

    • Sequential treatments (ER stress followed by pathogen or vice versa)

    • Co-treatment conditions to assess simultaneous response

    • Genetic rescue experiments using UPR components

Research has shown that loss of function in UBC32/33/34 does not affect certain immunity responses (flg22 and elf18-triggered inhibition of seedling growth) but alters ER stress tolerance in ways that likely contribute to diminished immunity . This suggests that UBC33's role in immunity operates primarily through its contribution to ER homeostasis rather than direct participation in immune signaling cascades.

What is the relationship between UBC33 and the dual ubiquitin-activating system (DUAS) in plants?

The dual ubiquitin-activating system (DUAS) in plants represents a specialized configuration where multiple E1 enzymes differentially charge downstream E2 enzymes, creating a sophisticated regulatory network. UBC33's relationship with this system offers insights into the evolution of proteolytic regulation in plants:

  • Differential charging dynamics: Research has revealed that the Arabidopsis UBC32/33/34 E2 triplet are differentially charged by plant E1 enzymes . This selective activation creates a hierarchical organization within the ubiquitylation cascade, allowing for precise control of downstream proteolytic events. Experimental investigation of this phenomenon requires:

    • In vitro charging assays with different E1-UBC33 combinations

    • Structural analysis of E1-UBC33 interfaces to identify determinants of specificity

    • Kinetic measurements to quantify charging efficiency differences

  • DUAS conservation across species: The finding that tomato and Arabidopsis both exhibit differential charging of UBC32/33/34 by their respective E1 enzymes suggests DUAS may be an evolutionarily conserved feature in plants . Comparative genomics and biochemical studies across diverse plant species can further elucidate the evolutionary significance of this system.

  • Functional implications of DUAS: The differential charging of UBC33 by E1 enzymes likely creates distinct pools of activated E2 enzymes that participate in different cellular processes. This arrangement could enable:

    • Pathway-specific activation during stress responses

    • Developmental stage-specific proteolytic regulation

    • Subcellular compartment-specific ubiquitylation activities

  • Regulatory mechanisms: The control mechanisms that govern E1 preference for UBC33 remain poorly understood. Research questions include:

    • Whether post-translational modifications alter E1-UBC33 affinity

    • How cellular conditions (redox state, ATP levels) affect charging preferences

    • Whether accessory proteins modulate E1-UBC33 interactions

  • Integration with immunity pathways: The discovery that DUAS plays distinct roles in plant immunity through the differential charging of ERAD-associated E2s like UBC33 opens new avenues for understanding how proteolytic systems contribute to defense responses . This demonstrates that the relationship between UBC33 and DUAS has significant implications for plant stress adaptation and immunity.

The relationship between UBC33 and DUAS represents an important area for future research, as it connects basic mechanisms of protein ubiquitylation with specialized plant processes including immunity and stress responses. Understanding these connections will provide insights into how plants have evolved sophisticated proteolytic systems to meet their unique environmental challenges.

How do UBC32, UBC33, and UBC34 function collectively in ABA signaling and plant immunity?

The UBC32/33/34 triplet exhibits coordinated yet distinct functions in abscisic acid (ABA) signaling and plant immunity. This functional network represents a sophisticated control mechanism linking hormone signaling, protein quality control, and defense responses:

What are the key experimental controls needed when working with recombinant UBC33 in functional assays?

When designing experiments with recombinant UBC33, implementing appropriate controls is essential for result validity and interpretation. The following control strategies address common experimental challenges:

  • Enzyme activity controls:

    • Catalytically inactive UBC33 mutant (active site cysteine to alanine/serine mutation) serves as a negative control to verify that observed effects depend on UBC33's enzymatic activity

    • Commercial wild-type UBC33 with established activity as a positive control

    • Time-zero samples to establish baseline conditions

    • ATP-depleted reactions to confirm ATP dependence of the ubiquitylation cascade

  • Protein quality controls:

    • SDS-PAGE analysis to confirm protein purity (>85% as recommended for research applications)

    • Western blotting to verify identity and integrity

    • Dynamic light scattering to assess homogeneity

    • Thioester formation assay to confirm functional activity before complex experiments

  • Specificity controls:

    • Parallel experiments with related E2s (UBC32 and UBC34) to distinguish UBC33-specific effects

    • E1 enzyme panel to verify differential charging patterns

    • Competition assays with increasing concentrations of other E2s

    • Domain swap experiments to identify regions responsible for specific functions

  • System validation controls:

    • In vitro to in vivo correlation using UBC33 mutant plants

    • Complementation assays with wild-type and mutant versions of UBC33

    • Dose-response experiments to establish concentration dependencies

    • Temporal controls to account for reaction kinetics and equilibrium states

  • Technical controls:

    • No-enzyme controls for background ubiquitylation activity

    • Storage time controls to account for potential activity loss

    • Buffer-only controls to identify buffer component effects

    • Temperature controls to ensure optimal reaction conditions

For reconstitution experiments with UBC33, researchers should follow established protocols, reconstituting in deionized sterile water to 0.1-1.0 mg/mL concentration and adding glycerol (5-50% final concentration) for storage stability . Adhering to these control strategies ensures that experimental observations can be confidently attributed to UBC33 activity rather than artifacts or contaminating factors.

How can researchers effectively study the interaction between UBC33 and E3 ligases?

Investigating UBC33-E3 ligase interactions requires a multi-method approach that addresses both physical binding and functional cooperation. The following methodological framework enables comprehensive characterization of these critical interactions:

  • Binary interaction detection methods:

    • Yeast two-hybrid (Y2H) screening to identify candidate E3 ligases from Arabidopsis libraries

    • In vitro pull-down assays using purified components to confirm direct interactions

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) for quantitative binding parameters

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in plant cells

  • Structural characterization approaches:

    • Co-crystallization of UBC33 with E3 ligase domains to determine atomic-level interaction details

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

    • NMR spectroscopy to identify dynamic aspects of complex formation

    • Cross-linking mass spectrometry to capture transient interaction states

  • Functional interaction assays:

    • Reconstituted ubiquitylation assays with purified E1, UBC33, candidate E3 ligases, and substrates

    • Ubiquitin chain formation analysis to determine linkage types promoted by specific UBC33-E3 pairs

    • Competition assays between different E3 ligases for UBC33 binding

    • Mutagenesis of predicted interface residues to validate structural models

  • Cellular context investigation:

    • Co-immunoprecipitation from plant extracts under native conditions

    • Proximity labeling approaches (BioID or TurboID fusions) to capture interactions in living cells

    • Fluorescence resonance energy transfer (FRET) microscopy to visualize interactions in real-time

    • Genetic interaction studies comparing single and double mutants of UBC33 and partner E3 ligases

  • E3 ligase family analysis:

    • Systematic screening across different E3 ligase families (RING, HECT, U-box, RBR) to establish selectivity profiles

    • Comparison of UBC33 interactions with those of UBC32 and UBC34 to identify shared versus specific E3 partners

    • Evolutionary analysis of interaction conservation across plant species

Given that plants contain well over 1,000 E3 ligases , a strategic approach is to initially focus on E3 ligases involved in ER stress responses, ABA signaling, and immunity pathways, as these represent the known functional domains of UBC33. Understanding these interactions will provide insights into how UBC33 achieves functional specificity within the complex ubiquitylation landscape of plant cells.

What are the most promising research directions for understanding UBC33's role in plant adaptation to environmental stresses?

UBC33's position at the intersection of protein quality control, hormone signaling, and immunity presents several high-potential research directions for understanding plant stress adaptation:

  • Climate resilience mechanisms: Investigating UBC33's contribution to multiple stress responses suggests its potential as a target for enhancing plant resilience to climate change. Research priorities should include:

    • Comparative analysis of UBC33 function across plant species with varying stress tolerance

    • Evaluation of UBC33 expression and activity under combined stress conditions (drought + pathogen, heat + drought)

    • Development of UBC33 variants with enhanced stability or altered specificity for stress protection

  • Signaling network integration: UBC33 participates in both ABA signaling and immunity pathways, suggesting it may function as an integration node. Future research should explore:

    • Temporal coordination between hormone and defense signaling mediated by UBC33

    • Identification of substrates that function in multiple pathways

    • Mathematical modeling of UBC33-dependent network dynamics under fluctuating conditions

  • Subcellular compartmentalization: The role of UBC33 in ERAD suggests specialized function at the ER membrane. Research opportunities include:

    • Mapping UBC33 localization during different stress responses

    • Identifying compartment-specific interaction partners

    • Investigating potential movement between cellular compartments during stress adaptation

  • Post-translational regulation: Understanding how UBC33 itself is regulated during stress responses represents an important knowledge gap. Key questions include:

    • Whether UBC33 undergoes phosphorylation or other modifications that alter its activity

    • How UBC33 stability is controlled during different stresses

    • Whether UBC33 forms part of larger protein complexes with regulatory functions

  • Biotechnological applications: The essential role of UBC33 in plant immunity and stress responses suggests potential applications:

    • Development of UBC33 activity modulators for agricultural applications

    • Engineering of UBC33-based synthetic circuits for stress-dependent protein degradation

    • Creation of reporter systems based on UBC33 activity for early stress detection

The research finding that Arabidopsis UBC32/33/34 E2 triplet members are essential for plant immunity provides a strong foundation for these future directions. Understanding the mechanisms by which UBC33 contributes to multiple stress responses may reveal fundamental principles of plant adaptation and provide new strategies for improving crop resilience in changing environments.

How might comparative studies across plant species enhance our understanding of UBC33 function?

Comparative studies of UBC33 across diverse plant species offer powerful insights into evolutionary conservation, functional specialization, and potential agricultural applications:

  • Evolutionary conservation analysis: Comparing UBC33 sequences and functions across evolutionary distance provides insight into core versus species-specific roles:

    • Phylogenetic analysis across land plants to identify conserved domains and variable regions

    • Correlation of sequence divergence with habitat specialization

    • Identification of selective pressure signatures indicating functional importance

    • Reconstruction of ancestral UBC33 sequences to understand evolutionary trajectories

  • Crop plant comparisons: Examining UBC33 homologs in major crop species has direct translational potential:

    • Functional characterization in cereals, legumes, and other crop groups

    • Identification of natural variants associated with stress resilience

    • Correlation between UBC33 allelic variation and agronomic traits

    • Assessment of expression patterns in high-yielding versus stress-resistant cultivars

  • Model system cross-validation: The finding that both tomato and Arabidopsis UBC32/33/34 triplets are differentially charged by E1s and essential for plant immunity suggests functional conservation. Expanding this comparison provides numerous research opportunities:

    • Complementation studies across species to test functional interchangeability

    • Identification of conserved versus species-specific substrates

    • Comparative analysis of regulatory networks controlling UBC33 expression

    • Investigation of developmental roles across different plant life strategies

  • Specialized adaptation mechanisms: Plants from extreme environments may have evolved specialized UBC33 functions:

    • Comparison between glycophytes and halophytes for salt stress adaptations

    • Analysis of desert versus mesic species for drought-related modifications

    • Investigation of pathogen-specific adaptations in plants with different disease resistances

    • Study of UBC33 regulation in plants with different life histories (annual vs. perennial)

  • Translational research opportunities: Cross-species findings can inform biotechnological applications:

    • Identification of superior UBC33 variants for stress resilience engineering

    • Development of species-specific modulators of UBC33 activity

    • Creation of chimeric UBC33 proteins with novel properties

    • Design of broad-spectrum versus species-optimized modification strategies

Table 2: Cross-Species Comparison of UBC33 Characteristics

SpeciesUBC33 ConservationE1 Charging PatternRole in ImmunityRole in ER StressReference
Arabidopsis thalianaReferenceDifferentially charged by E1sEssentialCritical for tolerance
Solanum lycopersicum (Tomato)Conserved functionDifferentially charged by E1sEssentialPresumed important
Other speciesResearch opportunityResearch opportunityResearch opportunityResearch opportunity-

This comparative approach not only enhances fundamental understanding of UBC33 biology but also provides practical insights for agricultural applications. The demonstrated conservation of DUAS and UBC33 function between Arabidopsis and tomato suggests findings may be broadly applicable across flowering plants, increasing the potential impact of this research area.

What are the key takeaways about UBC33 for researchers entering this field?

For researchers entering the field of UBC33 biology, several key concepts provide the foundation for effective investigation and experimental design:

  • Functional context: UBC33 is a ubiquitin-conjugating enzyme (E2) that functions within the ubiquitin-proteasome system as part of a specialized triplet (UBC32/33/34) with roles in ERAD, ER stress responses, ABA signaling, and plant immunity . This multi-pathway involvement positions UBC33 as an important regulatory node in plant stress responses.

  • Mechanistic insights: UBC33 operates within a dual ubiquitin-activating system (DUAS) in which it is differentially charged by E1 enzymes, creating pathway-specific activation patterns . This selective charging likely contributes to the functional specificity of UBC33 in different cellular processes.

  • Biological significance: The UBC32/33/34 triplet is essential for plant immunity, with loss of function resulting in diminished defense capabilities . This immune function appears to operate primarily through regulation of ER stress tolerance rather than direct participation in immune signaling cascades.

  • Practical considerations: Working with recombinant UBC33 requires attention to protein stability and handling conditions. Optimal storage involves maintaining the protein at -20°C/-80°C with glycerol addition, avoiding repeated freeze-thaw cycles, and using appropriate reconstitution protocols .

  • Research opportunities: The field offers numerous opportunities for discovery, particularly in understanding:

    • The structural basis for differential E1 charging

    • The identity and regulation of UBC33 substrates

    • The coordination between UBC33 and its triplet partners

    • The evolutionary conservation of UBC33 function across plant species

    • The potential applications in enhancing plant stress resilience

  • Technical approaches: Successful UBC33 research combines genetic manipulation, biochemical characterization, and physiological phenotyping. The ability to work across these different levels of analysis is essential for developing a comprehensive understanding of UBC33 function.

By integrating these key concepts, new researchers can efficiently navigate the existing knowledge landscape and identify promising directions for investigation. The demonstrated importance of UBC33 in fundamental plant processes suggests that advancements in this field will contribute significantly to both basic plant biology and agricultural applications.

How does current research on UBC33 contribute to broader understanding of plant proteolytic systems?

Research on UBC33 provides valuable insights into the organization, regulation, and functional significance of plant proteolytic systems that extend beyond this specific enzyme:

  • Hierarchical organization: The discovery that Arabidopsis UBC33 is differentially charged by E1 enzymes exemplifies how selectivity is built into the ubiquitylation cascade. This hierarchical organization creates a sophisticated network in which specific E1-E2-E3 combinations process distinct sets of substrates, enabling precise regulation of protein degradation in response to different stimuli.

  • Functional specialization: The UBC32/33/34 triplet demonstrates how closely related E2 enzymes have evolved specialized functions while maintaining overlapping roles . This balance between redundancy and specialization is a recurring theme in plant proteolytic systems, likely contributing to both robustness and regulatory precision.

  • Cross-pathway integration: UBC33's involvement in both ERAD and immunity pathways illustrates how proteolytic systems integrate multiple cellular processes. This integration allows coordinated responses to complex environmental challenges and establishes proteolysis as a central regulatory mechanism rather than simply a protein disposal system.

  • Evolutionary conservation: The finding that both Arabidopsis and tomato UBC32/33/34 triplets are differentially charged by E1s and essential for plant immunity suggests evolutionary conservation of these regulatory mechanisms. This conservation highlights the fundamental importance of precise proteolytic control in plant biology.

  • Stress response coordination: The connection between altered ER stress tolerance in UBC33 mutants and diminished immunity demonstrates how proteolytic systems coordinate different stress responses. This coordination enables plants to prioritize resources and mount effective responses to multiple simultaneous challenges.

  • Subcellular compartmentalization: UBC33's role in ERAD highlights the importance of compartment-specific proteolytic systems. The organization of distinct but interconnected degradation pathways in different subcellular locations allows for localized protein quality control while maintaining cellular homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.