Recombinant Arabidopsis thaliana Probable VAMP-like protein At1g33475 (At1g33475)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PHYL1.2; At1g33475; F10C21.23; Phytolongin Phyl1.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PHYL1.2
Target Protein Sequence
MGSIQNTVHYCCVSRDNQIMYAYNNAGDHRNNESLAALCLEKTPPFHKWYFETRGKKTFG FLMKDDFVYFAIVDDVFKKSSVLDFLEKLRDELKEANKKNSRGSFSGSISFSNVQDQIVR RLIASLEFDHTCLPLSSPSIDGAEQSYASNSKAPLLGRSNKQDKKKGRDHAHSLRGIEIE EHRKSNDRGNVTECSNASSESATYVPRRGRSGGSQSIERKWRRQVKIVLAIDIAICLTLL GVWLAICHGIECTRS
Uniprot No.

Target Background

Function

Non-SNARE longin protein involved in membrane-trafficking machinery.

Database Links

KEGG: ath:AT1G33475

STRING: 3702.AT1G33475.1

UniGene: At.39933

Protein Families
Synaptobrevin family
Subcellular Location
Membrane; Single-pass type IV membrane protein.

Q&A

What are the optimal storage conditions for recombinant At1g33475?

For optimal stability and activity retention, the recombinant At1g33475 protein should be stored at -20°C to -80°C upon receipt. The protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For research applications requiring multiple use, aliquoting is necessary to avoid repeated freeze-thaw cycles which can significantly degrade protein integrity. Working aliquots can be stored at 4°C for up to one week, but longer term storage requires freezing conditions . Reconstitution protocols recommend using deionized sterile water to reach a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol (final concentration) for long-term storage stability.

How is recombinant At1g33475 protein expressed and purified?

The recombinant At1g33475 protein is expressed in E. coli expression systems with an N-terminal His-tag for purification purposes . The expression system is designed to produce the full-length protein (amino acids 1-255) with high fidelity to the native sequence. Purification is typically performed using affinity chromatography leveraging the His-tag, resulting in preparations with greater than 90% purity as determined by SDS-PAGE analysis . This approach allows for consistent production of research-grade protein suitable for functional and structural studies.

What experimental designs are most effective for studying At1g33475 protein interactions?

When investigating protein-protein interactions involving At1g33475, a robust experimental design should include both in vitro and in vivo approaches. For in vitro studies, co-immunoprecipitation experiments using the His-tagged recombinant protein as bait can identify direct binding partners. These should follow a true experimental research design with appropriate controls :

Experimental GroupControl GroupVariables Measured
His-tagged At1g33475Empty vector controlCo-precipitated proteins
Native plant extract with At1g33475 antibodyPre-immune serumInteracting protein complexes
Yeast two-hybrid with At1g33475 baitEmpty bait vectorGrowth on selective media, reporter gene activation

For in vivo validation, researchers should consider FRET or BiFC approaches in plant protoplasts, systematically manipulating expression levels while controlling for cellular localization artifacts. Randomization of biological replicates and blinding during analysis are crucial to minimize bias in interaction studies . Additionally, leveraging Arabidopsis thaliana natural variation data from repositories like AraPheno can provide valuable context for how these interactions might vary across ecotypes .

How can contradictory data on At1g33475 function be reconciled?

Contradictory findings regarding At1g33475 function can be addressed through a systematic meta-analysis approach combined with targeted validation experiments. First, researchers should:

  • Catalog all experimental conditions across contradictory studies, focusing on:

    • Expression systems used (E. coli vs. plant-based)

    • Protein modifications (tags, fusion partners)

    • Assay conditions (pH, salt concentration, temperature)

    • Plant growth conditions when phenotypes were assessed

  • Design validation experiments that test hypotheses explaining the contradictions:

HypothesisExperimental ApproachMeasured Outcome
Tag interferenceCompare His-tagged vs. untagged protein functionActivity in standard assays
Context-dependent functionTest activity in multiple membrane environmentsLocalization and interaction patterns
Post-translational modification differencesPhosphoproteomic analysis of recombinant vs. native proteinModification sites and functional impact
  • Utilize AraPheno database resources to examine if natural genetic variation in At1g33475 correlates with specific phenotypic differences across Arabidopsis ecotypes .

This methodical approach helps distinguish between technical artifacts and genuine biological complexity in protein function.

What are the most reliable methods for assessing the subcellular localization of At1g33475?

The assessment of At1g33475 subcellular localization requires complementary approaches to ensure reliability. Based on its classification as a VAMP-like protein, it likely associates with membrane compartments involved in vesicular trafficking. A comprehensive localization strategy should include:

  • Fluorescent protein fusion constructs:

    • N-terminal and C-terminal GFP fusions to determine if tag position affects localization

    • Transient expression in protoplasts followed by stable transformation in Arabidopsis

    • Co-localization with established organelle markers (Golgi, ER, endosomes)

  • Biochemical fractionation:

    • Differential centrifugation to separate membrane compartments

    • Immunoblotting of fractions with anti-His antibodies (for recombinant protein) or specific antibodies against native At1g33475

  • Immunogold electron microscopy for high-resolution localization:

    • Using antibodies against the His-tag or native protein

    • Quantification of gold particle distribution across cellular compartments

For each method, experimental design principles including adequate biological replicates, appropriate controls, and randomization should be implemented to ensure statistical validity of the results .

How should knockout/knockdown experiments be designed to study At1g33475 function?

Designing rigorous knockout/knockdown experiments for At1g33475 requires careful consideration of experimental design principles. The following methodological approach is recommended:

  • Generation of multiple independent transgenic lines:

    • CRISPR/Cas9-mediated knockout targeting different exons

    • RNAi-mediated knockdown with at least three independent constructs

    • Artificial microRNA approaches as complementary strategy

  • Validation of knockout/knockdown efficiency:

    • RT-qPCR to quantify transcript levels

    • Western blotting with specific antibodies to confirm protein reduction

    • Phenotypic rescue with the recombinant protein to confirm specificity

  • Experimental design structure:

    • Minimum of three biological replicates per transgenic line

    • Wild-type and vector-only controls grown under identical conditions

    • Randomized block design to control for position effects in growth chambers

    • Blind phenotypic analysis to prevent observer bias

  • Integration with existing natural variation data:

    • Compare knockout phenotypes with naturally occurring variants in the AraPheno database

    • Identify ecotypes with natural polymorphisms in At1g33475 for comparative studies

This comprehensive approach addresses potential confounding variables while ensuring reproducibility across independent biological systems .

What are the critical controls for protein-protein interaction studies with At1g33475?

Protein-protein interaction studies with At1g33475 require rigorous controls to distinguish genuine interactions from artifacts. A systematic control framework includes:

Control TypePurposeImplementation
Negative Binding ControlIdentify non-specific bindingEmpty bait vector; unrelated His-tagged protein
Positive Interaction ControlValidate assay functionalityKnown interacting protein pair from same pathway
Binding Buffer ControlsTest stringency effectsVariation in salt concentration (150-500 mM NaCl)
Detergent ControlsAssess membrane protein solubilization effectsCompare different detergents (Triton X-100, DDM, CHAPS)
Competition ControlsConfirm specificityExcess unlabeled protein to compete with labeled interaction
Subcellular Localization ControlVerify biological relevanceCo-localization of proposed interactors in planta

Additionally, researchers should consider that the His-tag on the recombinant At1g33475 may interfere with certain interactions. Complementary approaches using C-terminal tagged versions or tag-free proteins should be employed when feasible . For all interaction experiments, randomization of samples and blinding during analysis help minimize experimental bias .

How should researchers analyze phenotypic variations in At1g33475 mutant lines?

Analysis of phenotypic variations in At1g33475 mutant lines requires a comprehensive statistical approach that accounts for both genetic and environmental factors:

  • Experimental design considerations:

    • Use a minimum of three independent mutant lines (preferably targeting different regions of the gene)

    • Include heterozygous lines to assess potential dosage effects

    • Grow plants under multiple controlled environmental conditions to identify environment-sensitive phenotypes

    • Implement a randomized block design with adequate technical and biological replicates

  • Statistical analysis methodology:

    • Apply mixed-effect models to account for random effects from different plant batches

    • Perform ANOVA followed by appropriate post-hoc tests for multiple comparisons

    • Use principal component analysis for multi-variate phenotypic data

    • Calculate heritability estimates for each phenotypic trait

  • Integration with AraPheno database:

    • Compare observed phenotypes with natural variation data from diverse Arabidopsis ecotypes

    • Correlate phenotypic variations with known polymorphisms in At1g33475 and related genes

    • Perform co-expression analysis to identify genes with similar expression patterns

  • Visualization strategies:

    • Create phenotypic heat maps across developmental stages

    • Use box plots with individual data points to show distribution and outliers

    • Include effect size calculations alongside p-values for meaningful interpretation

This comprehensive approach ensures robust phenotypic characterization while facilitating integration with the broader Arabidopsis research community data .

What strategies should be employed for analyzing At1g33475 structure-function relationships?

Analyzing structure-function relationships for At1g33475 requires integration of computational predictions with experimental validation:

  • Computational analysis pipeline:

    • Homology modeling based on related VAMP/SNARE proteins with known structures

    • Prediction of functional domains and critical residues

    • Molecular dynamics simulations to assess conformational flexibility

    • Sequence conservation analysis across plant species to identify evolutionarily constrained regions

  • Experimental validation approach:

    • Site-directed mutagenesis of predicted functional residues in the recombinant protein

    • Domain deletion/swapping experiments to test modular function

    • Circular dichroism spectroscopy to assess secondary structure changes

    • Limited proteolysis to identify stable domains and flexible regions

  • Functional correlation analysis:

    • Test mutated versions in complementation assays with knockout lines

    • Assess protein-protein interaction capabilities of mutant variants

    • Examine subcellular localization changes resulting from structural alterations

    • Measure kinetic parameters of membrane association for different structural variants

  • Data integration framework:

    • Create a comprehensive database correlating structural features with functional outcomes

    • Develop predictive models of structure-function relationships

    • Visualize structural elements in the context of interaction networks

By systematically correlating structural features with functional outcomes, researchers can develop a mechanistic understanding of how At1g33475 contributes to cellular processes.

How can At1g33475 research be integrated with Arabidopsis phenome databases?

Integration of At1g33475 research with phenome databases like AraPheno requires a methodical data management approach:

  • Standardized phenotyping protocols:

    • Adopt community-standard phenotyping methods compatible with AraPheno database formats

    • Include detailed metadata on growth conditions, developmental stages, and measurement techniques

    • Implement calibration procedures to enable cross-laboratory comparisons

  • Data submission workflow:

    • Format phenotypic data according to AraPheno database requirements

    • Include full experimental design details and statistical methods

    • Provide raw data alongside processed results to enable reanalysis

  • Comparative analysis strategies:

    • Correlate At1g33475 mutant phenotypes with natural variation across Arabidopsis ecotypes

    • Identify phenotypic syndromes that co-vary with At1g33475 sequence polymorphisms

    • Perform genome-wide association studies using AraPheno data to identify genetic interactions

  • Visualization and knowledge discovery:

    • Create integrated phenotypic networks connecting At1g33475 to related genes

    • Develop interactive visualizations showing phenotypic effects across different genetic backgrounds

    • Implement machine learning approaches to predict phenotypic outcomes from genetic variation

This integration facilitates placing At1g33475 research within the broader context of Arabidopsis biology while leveraging the power of natural genetic variation for functional insights .

What experimental approaches can reveal the role of At1g33475 in plant stress responses?

Investigating At1g33475's role in plant stress responses requires a multi-faceted experimental approach:

Stress TypeExperimental ApproachMeasured ParametersAnalysis Method
Abiotic (drought, salt, temperature)Growth of mutant lines under controlled stress conditionsGrowth parameters, physiological responses (ROS, ion content)Mixed-model ANOVA, principal component analysis
Biotic (pathogen challenge)Infection assays with bacterial, fungal pathogensLesion size, pathogen proliferation, defense gene expressionTime-series analysis, sigmoidal curve fitting
Combined stressesFactorial design with multiple stress typesTranscriptome, metabolome profilesNetwork analysis, pathway enrichment

Key methodological considerations include:

  • Time-course experiments to capture dynamic responses

  • Dose-response relationships to identify sensitivity thresholds

  • Cellular localization studies under stress conditions to detect stress-induced relocalization

  • Protein interaction network analysis under normal versus stress conditions

Data from these experiments should be analyzed in the context of existing phenotypic databases to determine if natural variation in At1g33475 correlates with stress adaptation in different Arabidopsis ecotypes . This integration of experimental data with natural variation can provide evolutionary context for the protein's role in stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.