Recombinant Arabidopsis thaliana Probable xyloglucan glycosyltransferase 6 (CSLC6)

Shipped with Ice Packs
In Stock

Description

Recombinant Arabidopsis thaliana Probable Xyloglucan Glycosyltransferase 6 (CSLC6): Overview

Recombinant Arabidopsis thaliana Probable Xyloglucan Glycosyltransferase 6 (CSLC6) is a heterologously expressed protein encoded by the CSLC6 gene (UniProt ID: Q9SRT3). This enzyme belongs to the cellulose synthase-like C (CSLC) family in Arabidopsis thaliana, which is critical for synthesizing the β-1,4-glucan backbone of xyloglucan (XyG), a key hemicellulose in plant cell walls . The recombinant form is produced in E. coli, includes an N-terminal His-tag for purification, and spans the full-length sequence (1–682 amino acids) .

Functional Role in Xyloglucan Biosynthesis

CSLC6 is part of a five-member CSLC gene family (CSLC4, 5, 6, 8, 12) responsible for synthesizing the glucan backbone of XyG . Key findings include:

  • Genetic Evidence: A cslc quintuple mutant (lacking all five CSLC genes) exhibits no detectable XyG, confirming the collective role of CSLC proteins in backbone synthesis .

  • Tissue-Specific Expression: CSLC6 expression is restricted to flowers and seeds, unlike CSLC4 and CSLC5, which are broadly expressed .

  • Enzymatic Activity: Recombinant CSLC4 (a homolog) produces β-glucan oligomers in vitro, and co-expression with XXT1 (a xylosyltransferase) generates longer glucan chains .

Research Findings and Mutant Phenotypes

MutantXyG LevelsPhenotype
Single cslc mutantsNormalNo visible defects
Triple cslc456-1ReducedMild tissue-specific phenotypes (e.g., altered hypocotyl elongation)
Quintuple cslc mutantUndetectableNormal growth but compromised cell wall integrity; no compensatory gene expression

Key Observations:

  • XyG Biosynthesis: The CSLC family acts redundantly; loss of individual genes does not disrupt XyG, but higher-order mutants progressively reduce levels .

  • Interaction with XXT Proteins: CSLC4 interacts with XXT5 in the Golgi, suggesting coordinated backbone elongation and xylosylation .

  • Functional Redundancy: Complementation of the quintuple mutant with any single CSLC gene restores XyG synthesis, indicating overlapping enzymatic roles .

Applications and Research Implications

  • Basic Plant Biology: CSCL6 is a tool for studying XyG’s role in cell wall structure and growth regulation .

  • Biotechnology: Insights from cslc mutants could guide engineering of plant cell walls for agricultural or industrial applications (e.g., biofuel production) .

  • Structural Studies: Recombinant CSCL6 facilitates biochemical assays to elucidate glucan synthase mechanisms and interactions with other glycosyltransferases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify this in advance for preferential development.
Synonyms
CSLC6; At3g07330; F21O3.4; Probable xyloglucan glycosyltransferase 6; Cellulose synthase-like protein C6; AtCslC6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-682
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CSLC6
Target Protein Sequence
MSRSQNEEFQQWWNKQRDRNNHDVLYAGDDEAFLTVEIRTPATVDPDKDRIRTRTVRQLS RLYLLKFKQLASSFLWIGNSFLYLVRTANRRIANDNPPSVSSSARLYRLIKGFLVVVVLL LCFELAAYFKGWHFTPPSVASAEVAVEVVYAWWLEIRASYLAPPLQSLTNVCIVLFLIQS VDRLVLVLGCFWIKLRRIKPVASMEYPTKLVGEGVRLEDYPMVIVQIPMCNEKEVYQQSI GAVCMLDWPRERMLVQVLDDSSELDVQQLIKAEVQKWQQRGVRIVYRHRLIRTGYKAGNL KAAMNCEYVKDYEFVAIFDADFQPPADFLKKTVPHFKGNEELALVQTRWAFVNKDENLLT RLQNINLSFHFEVEQQVNGVFINFFGFNGTAGVWRIKALEDCGGWLERTTVEDMDIAVRA HLCGWKFIYLNDVKCLCELPESYEAYKKQQYRWHSGPMQLFRLCFFDILRSKVSAAKKAN MIFLFFLLRKLILPFYSFTLFCVILPLTMFFPEANLPSWVVCYIPGIMSILNIIPAPRSF PFIVPYLLFENTMSVTKFGAMISGLFKFDSSYEWVVTKKLGRSSEADLVAYAESGSLVES TTIQRSSSDSGLTELSKLGAAKKAGKTKRNRLYRTEIALAFILLAASVRSLLSAQGIHFY FLLFQGITFVIVGLDLIGEQVS
Uniprot No.

Target Background

Function

This protein is a probable beta-1,4-glucan synthase, likely involved in xyloglucan backbone synthesis rather than cellulose synthesis. It appears to function concurrently with xyloglucan 6-xylosyltransferase. Xyloglucan, a non-cellulosic polysaccharide in plant cell walls, comprises a glucan backbone substituted with xylose, galactose, and fucose.

Database Links

KEGG: ath:AT3G07330

STRING: 3702.AT3G07330.1

UniGene: At.26732

Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like C subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Mainly expressed in flowers and seeds, and, to a lower extent, in seedlings, roots, leaves and stems.

Q&A

What is the primary function of CSLC6 in Arabidopsis thaliana?

CSLC6 is one of five CSLC genes in Arabidopsis (CSLC4, CSLC5, CSLC6, CSLC8, and CSLC12) that collectively contribute to the synthesis of the β-1,4-glucan backbone of xyloglucan. This backbone serves as the structural foundation upon which other enzymes add side-chain modifications to form complete xyloglucan polymers. Genetic studies with higher-order CSLC mutants have demonstrated that these genes are responsible for XyG glucan backbone synthesis, with a quintuple mutant lacking all five CSLC genes showing no detectable xyloglucan . Each individual CSLC protein, including CSLC6, can function as a xyloglucan glucan synthase, as demonstrated through complementation experiments where any single CSLC gene can restore xyloglucan production in the quintuple mutant . CSLC6 specifically shows tissue-specific expression patterns, being highly expressed in pollen grains, suggesting specialized roles in reproductive tissues .

How is CSLC6 structurally organized to perform its function?

CSLC6, like other CSLC proteins, is an integral membrane glycosyltransferase belonging to the CAZy GT family 2, which comprises inverting integral membrane glycosyltransferases . The protein is predicted to contain six transmembrane domains (TMDs) that anchor it in the Golgi membrane . This membrane topology is crucial for its function in xyloglucan biosynthesis. The catalytic domain of CSLC6 faces the cytoplasmic side of the Golgi membrane, where it can access UDP-glucose, its donor substrate . As the enzyme catalyzes the addition of glucose residues to the growing glucan chain, the polymer is extruded through the channel formed by the transmembrane helices into the Golgi lumen . This arrangement allows the nascent glucan backbone to be immediately accessible to other enzymes involved in xyloglucan synthesis, such as xylosyltransferases (XXTs), which add xylose side chains to the backbone from within the Golgi lumen .

How does CSLC6 differ from other CSLC family members in Arabidopsis?

While all five Arabidopsis CSLC proteins share the capability to synthesize the XyG glucan backbone, they exhibit distinct expression patterns suggesting tissue-specific specialization. Analysis of publicly available expression databases and qRT-PCR studies has revealed that CSLC6 and CSLC12 are both highly expressed in pollen grains, whereas CSLC4 and CSLC8 show broader expression throughout vegetative tissues, and CSLC5 is predominantly expressed in developing seeds . This distinct expression profile suggests that CSLC6 plays a specialized role in male reproductive development. Despite these expression differences, functional studies with mutants have demonstrated substantial redundancy among CSLC family members. Single mutants for each CSLC gene, including CSLC6, maintain normal levels of xyloglucan, indicating that other family members can compensate for the loss of any individual CSLC protein . Only when multiple CSLC genes are disrupted do measurable reductions in xyloglucan content become apparent .

What is the tissue-specific expression profile of CSLC6?

CSLC6 exhibits a highly specific expression pattern within Arabidopsis tissues. According to data from the eFP Browser expression databases and confirmatory qRT-PCR analyses, CSLC6 is predominantly expressed in pollen grains . This contrasts with CSLC4 and CSLC8, which show widespread expression across vegetative tissues, albeit with CSLC8 expressed at lower levels compared to CSLC4 . The pollen-specific expression of CSLC6 suggests a specialized role in male gametophyte development and function, potentially contributing to pollen tube growth where rapid and precisely controlled cell wall synthesis is required. This tissue-specific expression pattern provides important context for researchers designing experiments to study CSLC6 function, indicating that pollen or pollen tubes would be the most relevant biological materials for investigating the native function of this particular glycosyltransferase.

How is CSLC6 subcellularly localized and how does this relate to its function?

As a glycosyltransferase involved in hemicellulose biosynthesis, CSLC6 is localized to the Golgi apparatus, the central hub for cell wall polysaccharide synthesis in plants. CSLC6 is an integral membrane protein embedded in the Golgi membrane with its catalytic domain oriented toward the cytosol, where it can access its substrate UDP-glucose . The transmembrane domains of CSLC6 form a channel through which the growing glucan chain is extruded into the Golgi lumen, where it becomes accessible to other enzymes in the xyloglucan biosynthetic pathway . This localization is critical for the coordinated synthesis of xyloglucan, as it allows for sequential modification of the glucan backbone by various glycosyltransferases organized in the Golgi apparatus. The orientation of CSLC6 with its catalytic domain on the cytoplasmic side and product extrusion into the Golgi lumen exemplifies the elegant spatial organization that enables the complex process of xyloglucan assembly.

What expression systems are optimal for producing recombinant CSLC6?

For successful production of recombinant CSLC6, researchers must consider several expression systems, each with distinct advantages:

  • Yeast expression systems: Pichia pastoris has been successfully used to express other CSLC proteins, notably CSLC4, which was shown to synthesize β-glucan when heterologously expressed . This eukaryotic system provides appropriate machinery for proper protein folding and post-translational modifications of plant membrane proteins.

  • Plant-based expression systems: Transient expression in Nicotiana benthamiana leaves or stable transformation of Arabidopsis cell cultures offers a native-like environment that preserves interactions with plant-specific chaperones and partner proteins.

  • Insect cell expression systems: Baculovirus-infected insect cells provide another eukaryotic platform with good capacity for membrane protein expression and correct folding.

  • Cell-free expression systems: These allow greater control over the reaction environment and can be coupled with artificial membranes for studying membrane proteins like CSLC6.

When expressing CSLC6, it's important to note that co-expression with interacting partners may enhance activity. For instance, studies have shown that CSLC4 produced longer insoluble β-(1→4) glucan oligomers when co-expressed with XXT1 in Pichia pastoris, whereas CSLC4 expressed alone only produced small soluble β-(1→4) glucan . This suggests that optimal expression of functional CSLC6 might require co-expression with xylosyltransferases or other partner proteins.

What methods are effective for analyzing CSLC6 enzymatic activity?

Several complementary approaches can be employed to assess the enzymatic activity of recombinant CSLC6:

  • Radioactive substrate incorporation assays: Using UDP-[14C]glucose to track incorporation into nascent glucan chains, followed by product isolation and quantification.

  • Mass spectrometry analysis: MALDI-TOF or LC-MS/MS analysis of reaction products can determine the length and composition of synthesized oligosaccharides.

  • HPAEC-PAD analysis: High-Performance Anion-Exchange Chromatography with Pulsed Amperometric Detection can characterize oligosaccharides released by specific hydrolytic enzymes like xyloglucan-specific endoglucanase .

  • Enzyme coupling assays: Detecting UDP release during glycosyl transfer using coupling enzymes with spectrophotometric monitoring.

  • In vitro reconstitution with partner enzymes: Co-expression or co-reconstitution of CSLC6 with XXT enzymes can monitor complete xyloglucan synthesis, as studies have shown that CSLC activity might be enhanced in the presence of these partner enzymes .

For in-depth structure analysis of synthesized products, oligosaccharide mass profiling (OLIMP) has been utilized in studies of xyloglucan, involving digestion with a xyloglucan-specific endoglucanase followed by MALDI-TOF mass spectrometry to detect characteristic XyG oligosaccharide ions . This approach can confirm whether the products synthesized by recombinant CSLC6 have the structural features of authentic xyloglucan.

What genetic approaches are most effective for investigating CSLC6 function in vivo?

Multiple genetic strategies can be employed to elucidate CSLC6 function:

  • Single and higher-order mutant analysis: Creating and characterizing T-DNA insertion mutants in CSLC6 alone and in combination with other CSLC genes has been a productive approach. Studies have shown that single cslc mutants maintain normal levels of xyloglucan due to functional redundancy, while progressive reduction in xyloglucan content is observed in double, triple, and quadruple mutants, with complete absence in the quintuple mutant . This systematic approach reveals both the collective importance of the CSLC family and potential specialized functions of individual members.

  • Complementation studies: Reintroducing CSLC6 under control of either its native promoter or tissue-specific promoters into cslc mutant backgrounds can confirm function and explore tissue-specific requirements. Complementation experiments have demonstrated that each of the five CSLC genes can restore xyloglucan synthesis in the quintuple mutant, confirming their shared biochemical function .

  • Promoter-reporter fusions: Creating transgenic plants with the CSLC6 promoter driving expression of reporter genes like GUS or fluorescent proteins allows visualization of expression patterns through histochemical staining or fluorescence microscopy.

  • Domain swapping and chimeric proteins: Creating chimeric proteins between CSLC6 and other CSLC family members can identify domains responsible for specific activities or substrate preferences.

  • Fluorescent protein tagging: Creating translational fusions with fluorescent proteins enables visualization of CSLC6 subcellular localization and dynamics in living cells.

Given CSLC6's predominant expression in pollen, researchers should focus on pollen-specific phenotypes when characterizing mutants, such as pollen tube growth rates, germination efficiency, or wall ultrastructure.

How does CSLC6 interact with other enzymes in the xyloglucan biosynthetic pathway?

CSLC6 likely functions within a multiprotein complex for coordinated xyloglucan synthesis. Evidence from studies of other CSLC proteins suggests that these interactions are essential for efficient synthesis:

  • Interactions with xylosyltransferases (XXTs): CSLC proteins interact with XXTs, which add xylose side chains to the glucan backbone. Research utilizing bimolecular fluorescent complementation (BiFC) and coimmunoprecipitation (co-IP) has investigated interactions among xyloglucan synthesizing proteins, including CSLC4, XXTs, and other modifying enzymes . These interactions may enhance CSLC processivity and promote synthesis of longer glucan chains.

  • Proposed multiprotein complex: The "xyloglucan synthase complex" likely includes CSLC proteins working in concert with XXTs and other enzymes that perform sequential modifications of the growing xyloglucan chain . These protein-protein interactions could facilitate substrate channeling and coordinate the activities of multiple enzymes.

  • Membrane topology considerations: The membrane organization of these proteins is critical, with CSLC6 having its catalytic domain facing the cytosol while XXTs and other modifying enzymes have catalytic domains in the Golgi lumen . This arrangement necessitates coordination between glucan synthesis and modification processes separated by the membrane barrier.

Experiments with CSLC4 have shown that when expressed in Pichia pastoris together with XXT1, it produced long insoluble β-(1→4) glucan oligomers, whereas CSLC4 expressed alone only produced small soluble β-(1→4) glucan . This strongly indicates that CSLC4 requires the presence of XXTs, most likely within a multiprotein complex, to synthesize longer glucan chains. Similar interactions might be critical for CSLC6 function, particularly in the specialized context of pollen development where it is predominantly expressed.

How do CSLC proteins coordinate with XXTs during xyloglucan biosynthesis?

The coordination between CSLC proteins and xylosyltransferases (XXTs) involves sophisticated spatial and functional integration:

  • Spatial organization in the Golgi membrane: CSLC proteins synthesize the β-1,4-glucan backbone from UDP-glucose on the cytoplasmic side of the Golgi membrane, with the growing chain being extruded through the membrane into the Golgi lumen . XXTs are type II membrane proteins with their catalytic domains facing the Golgi lumen, where they add xylose residues to the newly synthesized glucan backbone .

  • Physical constraints on enzyme activity: The membrane-anchored nature of these enzymes imposes limitations on their movement and interaction with the glucan substrate. In contrast to the behavior of soluble, truncated enzymes in in vitro studies, full-length XXTs attached to the Golgi membrane have restricted motional freedom and must continuously xylosylate a constantly elongating glucan chain synthesized by CSLCs .

  • Sequential xylosylation model: Research on XXTs suggests a model where XXT1 and XXT2 are responsible for adding xylose to the first two consecutive glucose residues (creating XXGG patterns), while XXT5 and its homologs (XXT3 and XXT4) complete the xylosylation by adding the third xylose, forming the XXXG pattern characteristic of Arabidopsis xyloglucan .

  • Structural basis for xylosylation patterns: Crystallographic and reverse genetic studies have revealed that steric constraints prevent XXTs from adding xylose residues in certain patterns when working on an elongating chain in the Golgi environment . For example, once a xylose residue is added, it may create steric hindrances that prevent addition of another xylose at certain positions, contributing to the regular patterns observed in natural xyloglucan .

Understanding these coordination mechanisms is crucial for researchers attempting to reconstitute functional CSLC6 activity in heterologous systems or interpreting phenotypes of complex mutants affecting multiple components of the xyloglucan biosynthetic machinery.

What evidence supports functional redundancy among CSLC family members?

Multiple lines of evidence demonstrate substantial functional redundancy among the five Arabidopsis CSLC proteins:

This functional redundancy, coupled with distinct expression patterns, suggests an evolutionary strategy ensuring robust xyloglucan production across different tissues and developmental stages, with specialized CSLC members like CSLC6 potentially optimized for specific contexts such as pollen development.

How can researchers distinguish the specific contribution of CSLC6 in a redundant system?

Given the substantial functional redundancy among CSLC family members, several strategic approaches can help isolate CSLC6-specific functions:

  • Tissue-specific analysis: Focus investigations on pollen and pollen tubes where CSLC6 shows highest expression . In these tissues, CSLC6 likely makes a more substantial contribution to xyloglucan synthesis compared to vegetative tissues where other CSLC genes predominate.

  • Promoter swap experiments: Express CSLC6 under promoters of other CSLC genes (and vice versa) to determine whether functional differences arise from the protein itself or merely from its expression pattern.

  • Domain swapping: Create chimeric proteins exchanging domains between CSLC6 and other CSLC proteins to identify regions responsible for any functional specificity.

  • Comparative biochemistry: Express recombinant CSLC6 alongside other CSLC proteins to compare their enzymatic properties, such as substrate affinity, processivity, or interaction partners.

  • Tissue-specific complementation: Reintroduce CSLC6 specifically in pollen of the quintuple mutant to assess its sufficiency for normal pollen development and function.

  • Fine-scale structural analysis: Compare xyloglucan structure in wild-type pollen versus pollen from various cslc mutant combinations to detect subtle structural differences potentially attributable to CSLC6.

These approaches can collectively provide insights into the specific contribution of CSLC6 despite the background of functional redundancy within the CSLC family.

What experimental data supports the role of CSLC proteins in xyloglucan biosynthesis?

Multiple experimental approaches have provided compelling evidence for the role of CSLC proteins, including CSLC6, in xyloglucan biosynthesis:

Experimental ApproachKey FindingsReference
Genetic analysisSingle cslc mutants showed normal XyG levels; higher-order mutants showed progressive reduction; quintuple mutant had no detectable XyG
Complementation studiesEach of the five CSLC genes could restore XyG production in the quintuple mutant
Expression analysisCSLC genes show tissue-specific expression patterns, with CSLC6 predominantly in pollen
Heterologous expressionRecombinant CSLC4 synthesized β-glucan in Pichia pastoris
Co-expression studiesCSLC4 + XXT1 produced longer insoluble β-glucan chains than CSLC4 alone
Oligosaccharide mass profilingMALDI-TOF analysis confirmed absence of XyG-specific oligosaccharides in quintuple mutant

These complementary approaches collectively establish that CSLC proteins function as xyloglucan glucan synthases, with different family members having overlapping biochemical functions but distinct expression patterns. The most definitive evidence comes from the quintuple cslc mutant lacking all five CSLC genes, which had no detectable xyloglucan as confirmed by multiple analytical methods, including immunolabeling, linkage analysis, and oligosaccharide mass profiling .

What phenotypes are associated with CSLC6 mutation compared to other CSLC mutants?

The phenotypic consequences of mutations in CSLC genes reveal important insights about their individual and collective functions:

MutantXyloglucan ContentGrowth PhenotypesReference
cslc6 single mutantNormalNo obvious defects
cslc double/triple mutantsProgressively reducedMild tissue-specific effects
cslc456812 quintuple mutantNone detectableSmaller rosettes, shorter inflorescence stems, root hair defects
cslc45612 quadruple mutantSeverely reducedRoot hair defects
xxt1 xxt2 double mutantNone detectableSimilar to cslc quintuple mutant

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.