ARC6 encodes a chloroplast-targeted DnaJ-like protein that resides in the plastid envelope membrane . It is closely related to Ftn2, a prokaryotic cell division protein found exclusively in cyanobacteria .
Key features of ARC6:
Synonyms: ARC6; At5g42480; MDH9.18; Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic
Molecular Weight: The imported polypeptide migrates as a slightly smaller molecule than the full-length translation product, indicating processing of the transit peptide .
Localization: The protein is localized to a ring at the center of the chloroplasts . Subcellular fractionation studies confirm its association with the inner envelope membrane of the chloroplast .
| Property | Description |
|---|---|
| Species | Arabidopsis thaliana |
| Source | E. coli |
| Tag | His |
| Form | Lyophilized powder |
| Amino Acid Sequence | ATLVSPPPSIDRPERHVPIPIDFYQVLGAQTHFLTDGIRRAFEARVSKPPQFGFSDDALI SRRQILQAACETLSNPRSRREYNEGLLDDEEATVITDVPWDKVPGALCVLQEGGETEIVL RVGEALLKERLPKSFKQDVVLVMALAFLDVSRDAMALDPPDFITGYEFVEEALKLLQEEG ASSLAPDLRAQIDETLEEITPRYVLELLGLPLGDDYAAKRLNGLSGVRNILWSVGGGGAS ALVGGLTREKFMNEAFLRMTAAEQVDLFVATPSNIPAESFEVYEVALALVAQAFIGKKPH LLQDADKQFQQLQQAKVMAMEIPAMLYDTRNNWEIDFGLERGLCALLIGKVDECRMWLGL DSEDSQYRNPAIVEFVLENSNRDDNDDLPGLCKLLETWLAGVVFPRFRDTKDKKFKLGDY YDDPMVLSYLERVEVVQGSPLAAAAAMARIGAEHVKASAMQALQKVFPSRYTDRNSAEPK DVQETVFSVDPVGNNVGRDGEPGVFIAEAVRPSENFETNDYAIRAGVSESSVDETTVEMS VADMLKEASVKILAAGVAIGLISLFSQKYFLKSSSSFQRKDMVSSMESDVATIGSVRADD SEALPRMDARTAENIVSKWQKIKSLAFGPDHRIEMLPEVLDGRMLKIWTDRAAETAQLGL VYDYTLLKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYTTRYEVFWS KSGWKITEGSVLAS |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles. |
| Reconstitution | Briefly centrifuge the vial prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquotting for long-term storage at -20℃/-80℃ is recommended. |
ARC6 plays a crucial role in the assembly and stabilization of the plastid-dividing FtsZ ring . FtsZ proteins are key components of the chloroplast division machinery, assembling into a ring at the division site in wild-type plants . In arc6 mutants, FtsZ proteins form numerous short, disorganized filament fragments .
Regulation of FtsZ Ring Formation: ARC6 promotes FtsZ filament formation in the chloroplast, whereas AtMinD inhibits it .
Interaction with ARC3: ARC6 directly binds to ARC3, enabling full-length ARC3 to interact with FtsZ proteins . ARC6 activates the inhibitory activity of ARC3 on the assembly of FtsZ filaments, fine-tuning this process via its J-like domain .
Coordination of Division Complexes: ARC6 coordinates the inner FtsZ ring and the outer DRP5B ring during chloroplast division .
PARC6 (PARALOG OF ARC6) also resides in the inner envelope membrane and negatively regulates FtsZ assembly . PARC6 acts downstream of ARC6 to position PLASTID DIVISION1 (PDV1), which recruits DYNAMIN-RELATED PROTEIN 5B (DRP5B) to the outer envelope membrane . The stromal region of PARC6 interacts with ARC3 and the Z-ring protein FtsZ2 .
| Protein | Interaction |
|---|---|
| ARC3 | Interacts with the stromal region of PARC6, contributing to the negative regulation of FtsZ assembly. |
| FtsZ2 | Interacts with the stromal region of PARC6, mediated by a conserved carboxyl-terminal peptide in FtsZ2. |
| PDV1 | The intermembrane space regions of PARC6 and PDV1 interact, consistent with PARC6's role in positioning PDV1. |
In Vitro Chloroplast Import Assay: Radiolabeled ARC6 protein is imported into isolated pea chloroplasts and is protected from degradation by thermolysin, confirming its import into chloroplasts . The imported polypeptide is processed, indicating transit peptide removal, and localizes to the membrane fraction .
ARC6-GFP Fusion: An ARC6-green fluorescent protein fusion protein localizes to a ring at the center of the chloroplasts and rescues the chloroplast division defect in the arc6 mutant .
Understanding the function and regulation of ARC6 can provide insights into:
Enhancing Crop Yield: Optimizing chloroplast division can lead to increased photosynthetic efficiency and biomass production.
Biotechnology: Manipulating ARC6 and related proteins can be a strategy for engineering chloroplasts for various applications.
ARC6 (ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6) is a bitopic transmembrane protein localized to the inner envelope membrane of chloroplasts that plays a central role in chloroplast division. It has its larger N-terminus protruding into the stroma and its smaller C-terminus residing within the intermembrane space (IMS) . ARC6 was inherited from the cyanobacterial endosymbiont and is localized to the mid-plastid division site .
The fundamental role of ARC6 is to coordinate the division machineries on both the inner and outer envelope membranes of the chloroplast. It functions as an FtsZ assembly factor that helps organize the FtsZ ring (Z-ring) on the stromal surface of the inner envelope membrane . Additionally, ARC6 facilitates communication between the inner and outer envelope membranes by interacting with PDV2, which recruits the dynamin-like ARC5 ring to the cytosolic surface of the outer envelope membrane .
The arc6 mutant of Arabidopsis exhibits dramatic chloroplast division defects. Key phenotypic characteristics include:
These observations indicate that ARC6 has a global effect on plastid development throughout vegetative cells, affecting both the proplastid phenotype and the proplastid population .
ARC6 is a bitopic transmembrane protein with a specific topology in the chloroplast inner envelope membrane:
The larger N-terminal domain (ARC6 N) protrudes into the chloroplast stroma
The protein contains a single transmembrane domain that anchors it to the inner envelope membrane
The smaller C-terminal domain (ARC6 C) extends into the intermembrane space (IMS) between the inner and outer envelope membranes
The stromal domain of ARC6 interacts with FtsZ2, a component of the Z-ring
The C-terminal domain in the intermembrane space interacts with the C-terminus of PDV2, which spans the outer envelope membrane
This topology is critical for ARC6 function as it allows the protein to physically link the stromal division machinery (FtsZ ring) with the cytosolic division components (ARC5) through its interaction with PDV2 .
ARC6 serves as a hub protein that interacts with several components of the chloroplast division machinery:
The interaction between ARC6 and FtsZ2 has been demonstrated to be direct and independent of other proteins through in vitro pull-down assays . Similarly, the direct interaction between ARC6 and MCD1 has been confirmed through both yeast two-hybrid and in vitro pull-down assays . The interaction with PDV2 involves a conserved C-terminal glycine residue in PDV2 that is essential for chloroplast division .
ARC6 plays a central role in coordinating the division machineries across the chloroplast envelope membranes through a sophisticated interaction network:
On the stromal side, ARC6 directly interacts with FtsZ2 through its N-terminal domain, promoting the assembly and stabilization of the FtsZ ring (Z-ring) at the division site . This tethers the FtsZ heteropolymers (composed of FtsZ1 and FtsZ2) to the inner envelope membrane, facilitating Z-ring formation .
Across the envelope membranes, ARC6's C-terminal domain extends into the intermembrane space where it interacts with the C-terminus of PDV2, a protein spanning the outer envelope membrane . This interaction is mediated by a conserved terminal glycine residue in PDV2 .
PDV2, in turn, recruits the dynamin-like protein ARC5 to the cytosolic surface of the outer envelope membrane at the division site .
This ARC6-PDV2 interaction effectively transmits positional information from the stromal Z-ring to the cytosolic surface, ensuring that the inner and outer division machineries are properly aligned. Genetic analysis has demonstrated that ARC6 is required for the positioning of PDV2 and ARC5, while PDV2 is not required for the mid-plastid localization of ARC6 . This hierarchical relationship confirms that ARC6 acts upstream of PDV2 in the division site-specification pathway, establishing a physical link across the envelope membranes that synchronizes the scission of both membranes during chloroplast division .
ARC6 represents an evolutionarily conserved component of the plastid division machinery with clear links to cyanobacterial ancestors:
ARC6 was inherited from the cyanobacterial endosymbiont that gave rise to chloroplasts, indicating its ancient evolutionary origin . This makes ARC6 particularly interesting from an evolutionary perspective as it represents a direct connection to the prokaryotic division machinery of the endosymbiont.
While ARC6 was retained from the cyanobacterial ancestor, its interaction partner PDV2 is found only in land plants . This indicates that the connection between ARC6 and PDV2 represents a plant-specific adaptation that evolved to coordinate the endosymbiont-derived and host-derived components of the chloroplast division machinery .
The research suggests that ARC6 plays a fundamental role in the evolutionary transition from the prokaryotic division system of the endosymbiont to the more complex division system found in modern chloroplasts, which incorporates both endosymbiont-derived components (like FtsZ and ARC6) and host-derived components (like ARC5 and PDV proteins) .
This evolutionary perspective highlights how ARC6 serves as a critical bridge between ancient cyanobacterial division mechanisms and the novel host-derived components that were recruited during the evolution of chloroplasts in plants.
The interaction between ARC6 and PDV2 is critical for proper chloroplast division and has been characterized in detail:
ARC6 and PDV2 interact through their C-terminal domains within the intermembrane space between the inner and outer envelope membranes . This interaction is consistent with their in vivo topologies, with ARC6 spanning the inner membrane and PDV2 spanning the outer membrane .
PDV2 proteins have a conserved 28-amino acid extension at their C-terminus (making them longer than PDV1 proteins) that includes a terminal glycine residue crucial for the interaction with ARC6 .
Experimental evidence demonstrates that mutation of this conserved C-terminal glycine in PDV2 (G307D) abolishes the interaction with ARC6 and prevents complementation of the pdv2 mutant phenotype . Specifically:
The ARC6-PDV2 interaction has functional consequences for the recruitment of division components:
This interaction represents an elegant solution to the challenge of coordinating division across the two envelope membranes, allowing ARC6 to relay information on Z-ring positioning through PDV2 to specify the site of ARC5 recruitment on the chloroplast surface .
ARC6 plays a crucial role in FtsZ ring assembly and stability during chloroplast division:
The stromal domain of ARC6 (ARC6 N) directly binds to FtsZ2, independently of other proteins, as demonstrated through in vitro pull-down assays . This direct interaction is specific to FtsZ2 rather than FtsZ1 .
ARC6 functions as a membrane anchor for FtsZ filaments:
The role of ARC6 in Z-ring assembly can be observed in vivo:
The relationship between ARC6 and Z-ring positioning involves additional proteins:
These findings establish that ARC6 serves as a critical factor for proper Z-ring assembly, integrating the assembly of FtsZ filaments with their correct positioning and tethering to the inner envelope membrane.
ARC6 interacts with the chloroplast Min (minicell) system, which is responsible for regulating division site positioning:
MCD1 (MULTIPLE CHLOROPLAST DIVISION SITE1) is a plant-specific protein that plays a role in Z-ring positioning and chloroplast division site placement . Research indicates that:
ARC6 influences the localization of MCD1 to membrane-tethered FtsZ filaments in vivo . This relationship is hierarchical:
MCD1 is required for the regulation of Z-ring positioning by other components of the chloroplast Min system:
These findings suggest that ARC6 serves as a connection point between the division machinery itself (FtsZ ring) and the Min system that regulates division site placement. ARC6 facilitates MCD1 recognition of membrane-tethered FtsZ filaments, which is essential for proper functioning of the Min system in regulating division site positioning .
Several complementary experimental approaches have proven effective for studying ARC6 interactions:
Yeast Two-Hybrid Assays:
In Vitro Pull-Down Assays:
Demonstrates direct binding between recombinant proteins
Example from research: GST-tagged MCD1 C-terminal domain precipitated His-ARC6 N using Glutathione-Sepharose beads
His-SUMO-FtsZ2 was precipitated by amylose resin beads coated with MBP-tagged ARC6 N, confirming direct interaction
Useful for testing bridging interactions (as demonstrated with ARC6 bridging FtsZ2 and MCD1)
Bimolecular Fluorescence Complementation (BiFC):
Immunoblotting:
Genetic Analysis:
Expression of Recombinant Proteins:
These techniques, often used in combination, provide complementary evidence for protein interactions and their functional significance in chloroplast division.
Generating and characterizing ARC6 mutants involves several key methodological approaches:
Generation of ARC6 Mutants:
T-DNA insertion lines: Arabidopsis T-DNA insertion collections provide a source of arc6 mutant alleles
Complementation constructs: ARC6 transgenes can be introduced to mutant backgrounds under either native or constitutive promoters
Domain-specific mutations: Constructs encoding ARC6 with specific domains deleted or modified can be created to study domain function
Fluorescent protein fusions: GFP-tagged ARC6 constructs enable visualization while maintaining function
Phenotypic Characterization:
Microscopic examination of fixed leaf cells to assess chloroplast number and morphology
Comparison of chloroplast phenotypes between wild-type, single mutants, and double mutants
Quantification of chloroplasts per cell (e.g., arc6 has 1-2 chloroplasts/cell compared to 25-60 in complemented lines)
Analysis of specialized cell types (e.g., stomatal guard cells) to assess plastid segregation defects
Molecular Characterization:
Immunoblotting to confirm absence of ARC6 protein in knockouts or expression of fusion proteins in transgenic lines
Localization studies using fluorescently tagged proteins to examine division ring components (FtsZ1-CFP, ARC6-GFP)
Analysis of other division proteins' localization patterns in the arc6 background to establish hierarchical relationships
Functional Complementation:
This comprehensive approach allows researchers to understand both the phenotypic consequences of ARC6 loss and the functional importance of specific protein domains and interactions.
Several imaging techniques have proven valuable for studying ARC6 localization and function:
Fluorescent Protein Fusions:
Bimolecular Fluorescence Complementation (BiFC):
Fixed-Cell Microscopy:
Confocal Microscopy:
Provides high-resolution imaging of fluorescently tagged proteins within chloroplasts
Allows visualization of protein localization at the division site
Can be used for time-lapse imaging to study dynamic aspects of the division process
Transmission Electron Microscopy:
Provides ultrastructural details of chloroplast morphology and division site constrictions
Useful for examining membrane architecture at the division site
Can reveal structural abnormalities in mutant chloroplasts
The combination of these techniques allows researchers to correlate protein localization with chloroplast division phenotypes and to dissect the hierarchical relationships between different components of the division machinery. For example, studies have used FtsZ1-CFP imaging to demonstrate that FtsZ forms short filaments in arc6 mutants but multiple rings in mcd1 mutants, providing insight into the functional relationships between these proteins .
Research on ARC6 has employed several strategies for expressing and purifying recombinant protein for in vitro studies:
Protein Domain Selection:
Due to its membrane-spanning nature, full-length ARC6 is challenging to express in soluble form
Researchers typically express specific domains separately:
Fusion Tags for Solubility and Purification:
Expression Systems:
Handling Challenging Interaction Partners:
Pull-Down Assay Conditions:
For ARC6-FtsZ2 interaction: His-SUMO-FtsZ2 was precipitated by amylose resin beads coated with MBP-tagged ARC6 N
For ARC6-MCD1 interaction: His-ARC6 N was precipitated from crude E. coli extracts by Glutathione-Sepharose beads coated with GST-tagged MCD1 C
For bridging interactions: Glutathione-Sepharose beads coated with GST-MCD1 C were incubated with His-SUMO-FtsZ2 in the presence of recombinant MBP-ARC6 N
These approaches have enabled researchers to demonstrate direct protein-protein interactions involving ARC6 and to characterize the biochemical basis for its function in chloroplast division.