Recombinant Arabidopsis thaliana Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic (ARC6)

Shipped with Ice Packs
In Stock

Description

Gene Information and Protein Characteristics

ARC6 encodes a chloroplast-targeted DnaJ-like protein that resides in the plastid envelope membrane . It is closely related to Ftn2, a prokaryotic cell division protein found exclusively in cyanobacteria .

Key features of ARC6:

  • UniProt ID: Q9FIG9

  • Synonyms: ARC6; At5g42480; MDH9.18; Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic

  • Protein Length: Full Length of Mature Protein (68-801 aa)

  • Molecular Weight: The imported polypeptide migrates as a slightly smaller molecule than the full-length translation product, indicating processing of the transit peptide .

  • Localization: The protein is localized to a ring at the center of the chloroplasts . Subcellular fractionation studies confirm its association with the inner envelope membrane of the chloroplast .

Table 1: Properties of Recombinant Arabidopsis thaliana ARC6 Protein

PropertyDescription
SpeciesArabidopsis thaliana
SourceE. coli
TagHis
FormLyophilized powder
Amino Acid SequenceATLVSPPPSIDRPERHVPIPIDFYQVLGAQTHFLTDGIRRAFEARVSKPPQFGFSDDALI SRRQILQAACETLSNPRSRREYNEGLLDDEEATVITDVPWDKVPGALCVLQEGGETEIVL RVGEALLKERLPKSFKQDVVLVMALAFLDVSRDAMALDPPDFITGYEFVEEALKLLQEEG ASSLAPDLRAQIDETLEEITPRYVLELLGLPLGDDYAAKRLNGLSGVRNILWSVGGGGAS ALVGGLTREKFMNEAFLRMTAAEQVDLFVATPSNIPAESFEVYEVALALVAQAFIGKKPH LLQDADKQFQQLQQAKVMAMEIPAMLYDTRNNWEIDFGLERGLCALLIGKVDECRMWLGL DSEDSQYRNPAIVEFVLENSNRDDNDDLPGLCKLLETWLAGVVFPRFRDTKDKKFKLGDY YDDPMVLSYLERVEVVQGSPLAAAAAMARIGAEHVKASAMQALQKVFPSRYTDRNSAEPK DVQETVFSVDPVGNNVGRDGEPGVFIAEAVRPSENFETNDYAIRAGVSESSVDETTVEMS VADMLKEASVKILAAGVAIGLISLFSQKYFLKSSSSFQRKDMVSSMESDVATIGSVRADD SEALPRMDARTAENIVSKWQKIKSLAFGPDHRIEMLPEVLDGRMLKIWTDRAAETAQLGL VYDYTLLKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYTTRYEVFWS KSGWKITEGSVLAS
PurityGreater than 90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
ReconstitutionBriefly centrifuge the vial prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquotting for long-term storage at -20℃/-80℃ is recommended.

Role in Chloroplast Division

ARC6 plays a crucial role in the assembly and stabilization of the plastid-dividing FtsZ ring . FtsZ proteins are key components of the chloroplast division machinery, assembling into a ring at the division site in wild-type plants . In arc6 mutants, FtsZ proteins form numerous short, disorganized filament fragments .

  • Regulation of FtsZ Ring Formation: ARC6 promotes FtsZ filament formation in the chloroplast, whereas AtMinD inhibits it .

  • Interaction with ARC3: ARC6 directly binds to ARC3, enabling full-length ARC3 to interact with FtsZ proteins . ARC6 activates the inhibitory activity of ARC3 on the assembly of FtsZ filaments, fine-tuning this process via its J-like domain .

  • Coordination of Division Complexes: ARC6 coordinates the inner FtsZ ring and the outer DRP5B ring during chloroplast division .

Interaction with PARC6

PARC6 (PARALOG OF ARC6) also resides in the inner envelope membrane and negatively regulates FtsZ assembly . PARC6 acts downstream of ARC6 to position PLASTID DIVISION1 (PDV1), which recruits DYNAMIN-RELATED PROTEIN 5B (DRP5B) to the outer envelope membrane . The stromal region of PARC6 interacts with ARC3 and the Z-ring protein FtsZ2 .

Table 2: Interactions of PARC6

ProteinInteraction
ARC3Interacts with the stromal region of PARC6, contributing to the negative regulation of FtsZ assembly.
FtsZ2Interacts with the stromal region of PARC6, mediated by a conserved carboxyl-terminal peptide in FtsZ2.
PDV1The intermembrane space regions of PARC6 and PDV1 interact, consistent with PARC6's role in positioning PDV1.

Experimental Evidence

  • In Vitro Chloroplast Import Assay: Radiolabeled ARC6 protein is imported into isolated pea chloroplasts and is protected from degradation by thermolysin, confirming its import into chloroplasts . The imported polypeptide is processed, indicating transit peptide removal, and localizes to the membrane fraction .

  • ARC6-GFP Fusion: An ARC6-green fluorescent protein fusion protein localizes to a ring at the center of the chloroplasts and rescues the chloroplast division defect in the arc6 mutant .

Potential Applications

Understanding the function and regulation of ARC6 can provide insights into:

  • Enhancing Crop Yield: Optimizing chloroplast division can lead to increased photosynthetic efficiency and biomass production.

  • Biotechnology: Manipulating ARC6 and related proteins can be a strategy for engineering chloroplasts for various applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. Specify your required tag type in advance for preferential development.
Synonyms
ARC6; At5g42480; MDH9.18; Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
68-801
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ARC6
Target Protein Sequence
ATLVSPPPSIDRPERHVPIPIDFYQVLGAQTHFLTDGIRRAFEARVSKPPQFGFSDDALI SRRQILQAACETLSNPRSRREYNEGLLDDEEATVITDVPWDKVPGALCVLQEGGETEIVL RVGEALLKERLPKSFKQDVVLVMALAFLDVSRDAMALDPPDFITGYEFVEEALKLLQEEG ASSLAPDLRAQIDETLEEITPRYVLELLGLPLGDDYAAKRLNGLSGVRNILWSVGGGGAS ALVGGLTREKFMNEAFLRMTAAEQVDLFVATPSNIPAESFEVYEVALALVAQAFIGKKPH LLQDADKQFQQLQQAKVMAMEIPAMLYDTRNNWEIDFGLERGLCALLIGKVDECRMWLGL DSEDSQYRNPAIVEFVLENSNRDDNDDLPGLCKLLETWLAGVVFPRFRDTKDKKFKLGDY YDDPMVLSYLERVEVVQGSPLAAAAAMARIGAEHVKASAMQALQKVFPSRYTDRNSAEPK DVQETVFSVDPVGNNVGRDGEPGVFIAEAVRPSENFETNDYAIRAGVSESSVDETTVEMS VADMLKEASVKILAAGVAIGLISLFSQKYFLKSSSSFQRKDMVSSMESDVATIGSVRADD SEALPRMDARTAENIVSKWQKIKSLAFGPDHRIEMLPEVLDGRMLKIWTDRAAETAQLGL VYDYTLLKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYTTRYEVFWS KSGWKITEGSVLAS
Uniprot No.

Target Background

Function
Arabidopsis thaliana ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6 (ARC6), a chloroplastic protein, is a component of the plastid division machinery. It plays a crucial role in initiating proplastid and plastid division (including chloroplasts, statoliths, and leukoplasts). ARC6 promotes the assembly and/or stabilization of the plastid-dividing FtsZ ring, acting as an antagonistic regulator of FtsZ dynamics against CDP1. It relays plastid division site positioning between the stroma and outer surface through interactions with the stromal FtsZ ring and the outer membrane PDV2, which recruits the cytoplasmic ARC5 ring. ARC6 is required for the equatorial positioning of PDV2 and ARC5 on the plastid. Furthermore, it may contribute to gravitropism in stems and hypocotyls and influences stromule (stroma-filled tubular extensions of the plastid envelope membrane) length and frequency.
Gene References Into Functions
  1. The ARC6 intermembrane space region contains a structurally uncharacterized DUF4101 domain, highly conserved among ARC6 and Ftn2 proteins. This study presents the crystal structure of this domain. PMID: 26452626
  2. These findings indicate that, in addition to ARC6-mediated anchoring, an alternative FtsZ-anchoring mechanism exists in chloroplasts. PMID: 23578755
  3. This study reports the impact of reduced chloroplast number on photosynthetic leaf competence in A. thaliana mutants with alterations at ACCUMULATION AND REPLICATION OF CHLOROPLASTS (ARC) sites ARC3, ARC5, and ARC6. PMID: 16170638
  4. Changes in stromule length were observed in arc3 and arc6 mutants, despite maintaining wild-type plastid densities. PMID: 18764889
Database Links

KEGG: ath:AT5G42480

STRING: 3702.AT5G42480.1

UniGene: At.30169

Subcellular Location
Plastid, chloroplast inner membrane; Single-pass membrane protein. Note=Localized to a ring at the center of the chloroplasts (equatorial positioning) prior to and during constriction.

Q&A

What is ARC6 and what is its fundamental role in chloroplast division?

ARC6 (ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6) is a bitopic transmembrane protein localized to the inner envelope membrane of chloroplasts that plays a central role in chloroplast division. It has its larger N-terminus protruding into the stroma and its smaller C-terminus residing within the intermembrane space (IMS) . ARC6 was inherited from the cyanobacterial endosymbiont and is localized to the mid-plastid division site .

The fundamental role of ARC6 is to coordinate the division machineries on both the inner and outer envelope membranes of the chloroplast. It functions as an FtsZ assembly factor that helps organize the FtsZ ring (Z-ring) on the stromal surface of the inner envelope membrane . Additionally, ARC6 facilitates communication between the inner and outer envelope membranes by interacting with PDV2, which recruits the dynamin-like ARC5 ring to the cytosolic surface of the outer envelope membrane .

What phenotypes are observed in ARC6 mutant plants?

The arc6 mutant of Arabidopsis exhibits dramatic chloroplast division defects. Key phenotypic characteristics include:

These observations indicate that ARC6 has a global effect on plastid development throughout vegetative cells, affecting both the proplastid phenotype and the proplastid population .

What is the molecular structure and membrane topology of ARC6?

ARC6 is a bitopic transmembrane protein with a specific topology in the chloroplast inner envelope membrane:

  • The larger N-terminal domain (ARC6 N) protrudes into the chloroplast stroma

  • The protein contains a single transmembrane domain that anchors it to the inner envelope membrane

  • The smaller C-terminal domain (ARC6 C) extends into the intermembrane space (IMS) between the inner and outer envelope membranes

  • The stromal domain of ARC6 interacts with FtsZ2, a component of the Z-ring

  • The C-terminal domain in the intermembrane space interacts with the C-terminus of PDV2, which spans the outer envelope membrane

This topology is critical for ARC6 function as it allows the protein to physically link the stromal division machinery (FtsZ ring) with the cytosolic division components (ARC5) through its interaction with PDV2 .

What proteins interact with ARC6 during chloroplast division?

ARC6 serves as a hub protein that interacts with several components of the chloroplast division machinery:

Interacting ProteinLocationInteraction DomainFunction of Interaction
FtsZ2StromaN-terminal domain of ARC6Tethers FtsZ heteropolymers to the inner membrane; promotes Z-ring formation
PDV2Outer envelope membraneC-terminal domain of ARC6 interacts with PDV2's C-terminus in the intermembrane spaceCoordinates inner and outer membrane division machineries; recruits ARC5 to division site
MCD1Inner envelope membraneStromal regions of both proteinsMCD1 associates with membrane-tethered FtsZ filaments in an ARC6-dependent manner

The interaction between ARC6 and FtsZ2 has been demonstrated to be direct and independent of other proteins through in vitro pull-down assays . Similarly, the direct interaction between ARC6 and MCD1 has been confirmed through both yeast two-hybrid and in vitro pull-down assays . The interaction with PDV2 involves a conserved C-terminal glycine residue in PDV2 that is essential for chloroplast division .

How does ARC6 coordinate the inner and outer chloroplast division machineries?

ARC6 plays a central role in coordinating the division machineries across the chloroplast envelope membranes through a sophisticated interaction network:

  • On the stromal side, ARC6 directly interacts with FtsZ2 through its N-terminal domain, promoting the assembly and stabilization of the FtsZ ring (Z-ring) at the division site . This tethers the FtsZ heteropolymers (composed of FtsZ1 and FtsZ2) to the inner envelope membrane, facilitating Z-ring formation .

  • Across the envelope membranes, ARC6's C-terminal domain extends into the intermembrane space where it interacts with the C-terminus of PDV2, a protein spanning the outer envelope membrane . This interaction is mediated by a conserved terminal glycine residue in PDV2 .

  • PDV2, in turn, recruits the dynamin-like protein ARC5 to the cytosolic surface of the outer envelope membrane at the division site .

This ARC6-PDV2 interaction effectively transmits positional information from the stromal Z-ring to the cytosolic surface, ensuring that the inner and outer division machineries are properly aligned. Genetic analysis has demonstrated that ARC6 is required for the positioning of PDV2 and ARC5, while PDV2 is not required for the mid-plastid localization of ARC6 . This hierarchical relationship confirms that ARC6 acts upstream of PDV2 in the division site-specification pathway, establishing a physical link across the envelope membranes that synchronizes the scission of both membranes during chloroplast division .

What is the evolutionary origin of ARC6 and its relationship to cyanobacterial proteins?

ARC6 represents an evolutionarily conserved component of the plastid division machinery with clear links to cyanobacterial ancestors:

  • ARC6 was inherited from the cyanobacterial endosymbiont that gave rise to chloroplasts, indicating its ancient evolutionary origin . This makes ARC6 particularly interesting from an evolutionary perspective as it represents a direct connection to the prokaryotic division machinery of the endosymbiont.

  • While ARC6 was retained from the cyanobacterial ancestor, its interaction partner PDV2 is found only in land plants . This indicates that the connection between ARC6 and PDV2 represents a plant-specific adaptation that evolved to coordinate the endosymbiont-derived and host-derived components of the chloroplast division machinery .

  • The research suggests that ARC6 plays a fundamental role in the evolutionary transition from the prokaryotic division system of the endosymbiont to the more complex division system found in modern chloroplasts, which incorporates both endosymbiont-derived components (like FtsZ and ARC6) and host-derived components (like ARC5 and PDV proteins) .

This evolutionary perspective highlights how ARC6 serves as a critical bridge between ancient cyanobacterial division mechanisms and the novel host-derived components that were recruited during the evolution of chloroplasts in plants.

How does the interaction between ARC6 and PDV2 regulate chloroplast division?

The interaction between ARC6 and PDV2 is critical for proper chloroplast division and has been characterized in detail:

  • ARC6 and PDV2 interact through their C-terminal domains within the intermembrane space between the inner and outer envelope membranes . This interaction is consistent with their in vivo topologies, with ARC6 spanning the inner membrane and PDV2 spanning the outer membrane .

  • PDV2 proteins have a conserved 28-amino acid extension at their C-terminus (making them longer than PDV1 proteins) that includes a terminal glycine residue crucial for the interaction with ARC6 .

  • Experimental evidence demonstrates that mutation of this conserved C-terminal glycine in PDV2 (G307D) abolishes the interaction with ARC6 and prevents complementation of the pdv2 mutant phenotype . Specifically:

    • Wild-type PDV2 transgenes fully complemented the pdv2 phenotype

    • PDV2 G307D transgenes showed no modification of the pdv2 phenotype, despite protein levels equivalent to or greater than wild-type PDV2

  • The ARC6-PDV2 interaction has functional consequences for the recruitment of division components:

    • ARC6 acts upstream of PDV2 to localize PDV2 (and consequently ARC5) to the division site

    • This positioning mechanism ensures proper alignment of the inner and outer membrane division machineries

This interaction represents an elegant solution to the challenge of coordinating division across the two envelope membranes, allowing ARC6 to relay information on Z-ring positioning through PDV2 to specify the site of ARC5 recruitment on the chloroplast surface .

What is the relationship between ARC6 and FtsZ ring assembly?

ARC6 plays a crucial role in FtsZ ring assembly and stability during chloroplast division:

  • The stromal domain of ARC6 (ARC6 N) directly binds to FtsZ2, independently of other proteins, as demonstrated through in vitro pull-down assays . This direct interaction is specific to FtsZ2 rather than FtsZ1 .

  • ARC6 functions as a membrane anchor for FtsZ filaments:

    • In the absence of ARC6 (arc6 mutant), FtsZ proteins form short, disorganized filaments instead of the organized Z-ring at the division site

    • ARC6 tethers FtsZ heteropolymers (composed of FtsZ1 and FtsZ2) to the inner envelope membrane, primarily through the direct interaction with FtsZ2

  • The role of ARC6 in Z-ring assembly can be observed in vivo:

    • In wild-type plants, FtsZ1-CFP localizes to a mid-chloroplast ring

    • In arc6 mutants, FtsZ1-CFP signals are detected as short filaments rather than complete rings

    • Expression of full-length ARC6-GFP in the arc6 background rescues this phenotype

  • The relationship between ARC6 and Z-ring positioning involves additional proteins:

    • MCD1 associates with membrane-tethered FtsZ filaments in an ARC6-dependent manner

    • In the mcd1 mutant, ARC6, FtsZ1, and FtsZ2 localize to multiple ring structures

    • Genetic analysis shows that ARC6 acts upstream of MCD1 in Z-ring positioning

These findings establish that ARC6 serves as a critical factor for proper Z-ring assembly, integrating the assembly of FtsZ filaments with their correct positioning and tethering to the inner envelope membrane.

How does ARC6 interact with the Min system for division site positioning?

ARC6 interacts with the chloroplast Min (minicell) system, which is responsible for regulating division site positioning:

  • MCD1 (MULTIPLE CHLOROPLAST DIVISION SITE1) is a plant-specific protein that plays a role in Z-ring positioning and chloroplast division site placement . Research indicates that:

    • MCD1 is a bitopic inner membrane protein whose C-terminus faces the chloroplast stroma

    • MCD1 and ARC6 directly interact in the stroma through their respective C-terminal and N-terminal domains

    • MCD1 binds to FtsZ2 in an ARC6-dependent manner

  • ARC6 influences the localization of MCD1 to membrane-tethered FtsZ filaments in vivo . This relationship is hierarchical:

    • In the mcd1 arc6 double mutant, the phenotype resembles that of the single arc6 mutant rather than mcd1, suggesting MCD1 acts downstream of ARC6

    • FtsZ1-CFP localizes to short filaments in both arc6 and mcd1 arc6 mutants, but forms multiple rings in the mcd1 single mutant

  • MCD1 is required for the regulation of Z-ring positioning by other components of the chloroplast Min system:

    • ARC3 and MinE1 are components of the chloroplast Min system that negatively regulate Z-ring placement

    • MCD1 is required for these components to properly regulate Z-ring positioning

These findings suggest that ARC6 serves as a connection point between the division machinery itself (FtsZ ring) and the Min system that regulates division site placement. ARC6 facilitates MCD1 recognition of membrane-tethered FtsZ filaments, which is essential for proper functioning of the Min system in regulating division site positioning .

What experimental approaches are effective for studying ARC6-protein interactions?

Several complementary experimental approaches have proven effective for studying ARC6 interactions:

  • Yeast Two-Hybrid Assays:

    • Used successfully to detect direct protein-protein interactions between ARC6 and its partners

    • Enables mapping of interaction domains by testing truncated versions of proteins

    • Limited to soluble protein domains or fragments

  • In Vitro Pull-Down Assays:

    • Demonstrates direct binding between recombinant proteins

    • Example from research: GST-tagged MCD1 C-terminal domain precipitated His-ARC6 N using Glutathione-Sepharose beads

    • His-SUMO-FtsZ2 was precipitated by amylose resin beads coated with MBP-tagged ARC6 N, confirming direct interaction

    • Useful for testing bridging interactions (as demonstrated with ARC6 bridging FtsZ2 and MCD1)

  • Bimolecular Fluorescence Complementation (BiFC):

    • Used to visualize protein-protein interactions in vivo

    • Applied in Arabidopsis protoplasts to study ARC6-dependent interactions

    • Allows assessment of how mutations affect interaction patterns

  • Immunoblotting:

    • Confirms expression of fusion proteins in transgenic plants

    • Used to validate protein accumulation in complementation experiments

  • Genetic Analysis:

    • Creation of single and double mutants (e.g., mcd1 arc6) to establish hierarchical relationships

    • Expressing tagged versions of proteins in mutant backgrounds to assess rescue capabilities

  • Expression of Recombinant Proteins:

    • Various tags used to improve solubility (SUMO, GST, MBP, His)

    • Strategies to overcome insolubility issues (e.g., SUMO tag to obtain soluble FtsZ2)

These techniques, often used in combination, provide complementary evidence for protein interactions and their functional significance in chloroplast division.

How can researchers generate and characterize ARC6 mutants?

Generating and characterizing ARC6 mutants involves several key methodological approaches:

  • Generation of ARC6 Mutants:

    • T-DNA insertion lines: Arabidopsis T-DNA insertion collections provide a source of arc6 mutant alleles

    • Complementation constructs: ARC6 transgenes can be introduced to mutant backgrounds under either native or constitutive promoters

    • Domain-specific mutations: Constructs encoding ARC6 with specific domains deleted or modified can be created to study domain function

    • Fluorescent protein fusions: GFP-tagged ARC6 constructs enable visualization while maintaining function

  • Phenotypic Characterization:

    • Microscopic examination of fixed leaf cells to assess chloroplast number and morphology

    • Comparison of chloroplast phenotypes between wild-type, single mutants, and double mutants

    • Quantification of chloroplasts per cell (e.g., arc6 has 1-2 chloroplasts/cell compared to 25-60 in complemented lines)

    • Analysis of specialized cell types (e.g., stomatal guard cells) to assess plastid segregation defects

  • Molecular Characterization:

    • Immunoblotting to confirm absence of ARC6 protein in knockouts or expression of fusion proteins in transgenic lines

    • Localization studies using fluorescently tagged proteins to examine division ring components (FtsZ1-CFP, ARC6-GFP)

    • Analysis of other division proteins' localization patterns in the arc6 background to establish hierarchical relationships

  • Functional Complementation:

    • Introduction of wild-type or modified ARC6 constructs into arc6 mutants to assess rescue capabilities

    • Quantification of chloroplast number and size to determine degree of complementation

    • Expression of ARC6 deletion variants to map functionally essential domains

This comprehensive approach allows researchers to understand both the phenotypic consequences of ARC6 loss and the functional importance of specific protein domains and interactions.

What imaging techniques are optimal for visualizing ARC6 localization and function?

Several imaging techniques have proven valuable for studying ARC6 localization and function:

  • Fluorescent Protein Fusions:

    • ARC6-GFP fusions reveal the mid-chloroplast localization of ARC6

    • FtsZ1-CFP constructs allow visualization of Z-ring formation and positioning

    • These fusions can be expressed under native promoters to maintain physiological expression levels

  • Bimolecular Fluorescence Complementation (BiFC):

    • Enables visualization of protein-protein interactions in vivo

    • Used to study interactions between ARC6 and its binding partners in Arabidopsis protoplasts

    • Can reveal how mutations or absence of specific proteins affect interaction patterns

  • Fixed-Cell Microscopy:

    • Examination of fixed leaf mesophyll cells provides clear visualization of chloroplast number and morphology

    • Useful for phenotypic characterization of mutants and transgenic complementation lines

    • Can be used to quantify chloroplast number per cell and assess division defects

  • Confocal Microscopy:

    • Provides high-resolution imaging of fluorescently tagged proteins within chloroplasts

    • Allows visualization of protein localization at the division site

    • Can be used for time-lapse imaging to study dynamic aspects of the division process

  • Transmission Electron Microscopy:

    • Provides ultrastructural details of chloroplast morphology and division site constrictions

    • Useful for examining membrane architecture at the division site

    • Can reveal structural abnormalities in mutant chloroplasts

The combination of these techniques allows researchers to correlate protein localization with chloroplast division phenotypes and to dissect the hierarchical relationships between different components of the division machinery. For example, studies have used FtsZ1-CFP imaging to demonstrate that FtsZ forms short filaments in arc6 mutants but multiple rings in mcd1 mutants, providing insight into the functional relationships between these proteins .

What are effective strategies for expressing and purifying recombinant ARC6 for in vitro studies?

Research on ARC6 has employed several strategies for expressing and purifying recombinant protein for in vitro studies:

  • Protein Domain Selection:

    • Due to its membrane-spanning nature, full-length ARC6 is challenging to express in soluble form

    • Researchers typically express specific domains separately:

      • N-terminal stromal domain (ARC6 N) is commonly used for interaction studies

      • C-terminal intermembrane space domain (ARC6 C) can be expressed separately

  • Fusion Tags for Solubility and Purification:

    • His-tag: Used for ARC6 N purification via nickel affinity chromatography

    • MBP-tag (Maltose Binding Protein): Enhances solubility and enables purification via amylose resin

    • GST-tag (Glutathione S-Transferase): Used for pull-down assays with Glutathione-Sepharose beads

  • Expression Systems:

    • E. coli has been successfully used for expressing ARC6 domains

    • BL21(DE3) or similar strains are typically employed for recombinant protein expression

  • Handling Challenging Interaction Partners:

    • For insoluble proteins like FtsZ2, SUMO-tagging has been effective in obtaining soluble recombinant protein

    • His-SUMO-FtsZ2 fusion proteins have been successfully used in interaction studies, though they tend to co-purify with some degradation products

  • Pull-Down Assay Conditions:

    • For ARC6-FtsZ2 interaction: His-SUMO-FtsZ2 was precipitated by amylose resin beads coated with MBP-tagged ARC6 N

    • For ARC6-MCD1 interaction: His-ARC6 N was precipitated from crude E. coli extracts by Glutathione-Sepharose beads coated with GST-tagged MCD1 C

    • For bridging interactions: Glutathione-Sepharose beads coated with GST-MCD1 C were incubated with His-SUMO-FtsZ2 in the presence of recombinant MBP-ARC6 N

These approaches have enabled researchers to demonstrate direct protein-protein interactions involving ARC6 and to characterize the biochemical basis for its function in chloroplast division.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.