Recombinant Arabidopsis thaliana Protein Asterix (At5g07960)

What is Arabidopsis thaliana Protein Asterix and what are its key characteristics?

Protein Asterix (At5g07960) is a full-length protein from Arabidopsis thaliana consisting of 107 amino acids. The amino acid sequence is MSHSHGNASSVNDPRQPSAAKPYIPRPVAPEDLPVDYSGFIAVILGVSGVMFRYKICSWLAIIFCAQSLANMRNLENDLKQISMAMMFAIMGLVTNYLGPNRPATKK . It can be produced as a recombinant protein with an N-terminal His tag using bacterial expression systems, particularly E. coli. Like other recombinant proteins used in research, proper handling and storage are critical for maintaining its stability and function.

What are the optimal storage conditions for recombinant Protein Asterix?

Recombinant Protein Asterix should be stored at -20°C or -80°C upon receipt, with aliquoting necessary for multiple use. The protein is typically provided as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . It is recommended to add 5-50% glycerol (with 50% being the typical final concentration) and aliquot for long-term storage at -20°C/-80°C . Repeated freezing and thawing should be avoided as this can lead to protein degradation and loss of activity. For short-term use, working aliquots can be stored at 4°C for up to one week .

How should Protein Asterix be reconstituted for experimental use?

For proper reconstitution of Protein Asterix:

• Briefly centrifuge the vial prior to opening to bring the contents to the bottom

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (typically 50%) to prevent freezing damage

• Create multiple small aliquots to avoid repeated freeze-thaw cycles

• Store reconstituted protein at -20°C/-80°C for long-term storage or at 4°C for up to one week

The protein is provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during lyophilization and storage .

How can I design experiments to evaluate Protein Asterix function in plant stress responses?

When designing experiments to evaluate Protein Asterix function in stress responses:

• Include appropriate blocking in your experimental design to reduce variability within each experimental group, enhancing your ability to detect treatment effects with greater precision

• Ensure sufficient statistical power by reducing experimental variability, allowing you to detect true effects with fewer experimental units

• Incorporate controls to avoid confounding variables that might prevent accurate estimation of Protein Asterix effects

• Prevent pseudo-replication by ensuring true biological replication rather than technical replication

• Design comparative experiments with wild-type plants, knockout mutants, and overexpression lines to establish functional relationships

Based on methodologies used for other Arabidopsis proteins, consider examining expression patterns under various stress conditions (oxidative, drought, salt) using qRT-PCR or RNA-seq approaches similar to those used for ATR7 and AtRGGA studies .

What are the recommended methods for verifying the identity and purity of recombinant Protein Asterix?

To verify the identity and purity of recombinant Protein Asterix:

• SDS-PAGE analysis: Run the protein on SDS-PAGE to confirm the expected molecular weight (~37 kDa with His tag) and assess purity (should be >90%)

• Mass spectrometry verification:

  • Digest purified protein with trypsin

  • Subject digested peptides to MALDI-TOF/TOF analysis

  • Perform MS-MS ion search in databases like Mascot

  • Confirm sequence coverage against the expected Arabidopsis thaliana Protein Asterix sequence

• Western blot: Use anti-His antibodies to confirm the presence of the His tag and verify protein identity

• Sequence verification: Consider peptide mass fingerprinting (PMF) to match specific peptide peaks to the expected sequence, similar to the approach used for rAtAOX1A verification where six major peptide peaks provided 24% sequence coverage

How can I investigate Protein Asterix interactions with other cellular components?

To investigate Protein Asterix interactions:

• Protein localization studies: Create fusion proteins with fluorescent tags (GFP/YFP) to determine subcellular localization, as done with other Arabidopsis proteins like ATR7 and AtRGGA

• Co-immunoprecipitation (Co-IP):

  • Use the His tag for pull-down experiments

  • Identify interacting partners through mass spectrometry analysis

  • Apply liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS) for protein identification

• Yeast two-hybrid screening:

  • Use Protein Asterix as bait to identify potential protein-protein interactions

  • Validate interactions through in vitro and in vivo methods

• RNA interaction studies: If Protein Asterix has potential RNA-binding properties:

  • Perform RNA electromobility shift assays (EMSA) using recombinant His-tagged protein

  • Use biotin-labeled RNA extracted from control and stressed plants

What proteomics approaches are most effective for studying Protein Asterix in nuclear protein complexes?

For studying Protein Asterix in nuclear protein complexes:

• Nuclear isolation and fractionation:

  • Isolate nuclei from Arabidopsis tissues

  • Fractionate nuclear proteins using appropriate buffers

  • Process samples for LC-MS/MS analysis

• Quantitative proteomics workflow:

  • Dilute nuclear protein samples in Laemmli buffer with DTT

  • Load onto acrylamide gels for separation

  • Perform in-gel digestion with trypsin

  • Extract peptides with acetonitrile and formic acid

  • Analyze by nanoLC-MS/MS

• Protein identification and quantification:

  • Use search engines like Mascot against Arabidopsis thaliana protein databases (TAIR10)

  • Validate identifications with software like Proline

  • Maintain false discovery rates below 1% at both PSM and protein levels

• Differential abundance analysis:

  • Apply statistical methods like pairwise Limma t-tests

  • Use software such as Prostar for statistical analysis

How does Protein Asterix expression change under different stress conditions?

While specific data on Protein Asterix expression under stress is limited in the provided search results, you can design experiments similar to those used for other Arabidopsis proteins:

• Stress treatments:

  • Apply oxidative stress (hydrogen peroxide)

  • Test abiotic stresses (heat, cold, heavy metals like CdCl₂)

  • Induce osmotic stress with mannitol or salt (NaCl)

• Expression analysis methods:

  • Perform qRT-PCR for targeted expression analysis

  • Conduct RNA-seq for genome-wide expression profiling

  • Compare expression patterns across different tissues and developmental stages

• Protein abundance measurements:

  • Use Western blots with antibodies against the His tag or the protein itself

  • Apply quantitative proteomics approaches to measure changes in protein levels

  • Correlate transcript and protein abundance under various conditions

What are the most effective expression systems for producing high-quality recombinant Protein Asterix?

Based on the available information and standard practices for recombinant protein production:

• E. coli expression system:

  • Currently used successfully for Protein Asterix production

  • Advantages include high yield, rapid growth, and cost-effectiveness

  • Optimize expression conditions (temperature, IPTG concentration, expression time)

  • Consider testing different E. coli strains (BL21, Rosetta, etc.) for optimal expression

• Alternative expression systems to consider:

  • Plant-based expression systems for proper post-translational modifications

  • Insect cell/baculovirus systems for complex eukaryotic proteins

  • Cell-free protein synthesis for rapid production and avoiding toxicity issues

• Purification strategy optimization:

  • Utilize the His tag for immobilized metal affinity chromatography (IMAC)

  • Implement additional purification steps if needed (ion exchange, size exclusion)

  • Optimize buffer conditions to maintain protein stability and activity

How can I adapt proteomic methodologies to study specific modifications of Protein Asterix?

To study post-translational modifications (PTMs) of Protein Asterix:

• Sample preparation:

  • Enrich for specific PTMs (phosphorylation, ubiquitination, etc.)

  • Use appropriate protease digestion (trypsin, chymotrypsin, or combinations)

  • Apply PTM-specific enrichment techniques (TiO₂ for phosphopeptides, antibody-based enrichment)

• Advanced MS techniques:

  • Employ high-resolution mass spectrometry

  • Use fragmentation methods appropriate for PTM analysis (HCD, ETD)

  • Apply targeted approaches like parallel reaction monitoring (PRM) for specific sites

• Data analysis workflows:

  • Search against databases with variable modifications

  • Validate PTM identifications with appropriate scoring systems

  • Apply site localization algorithms to determine exact modification sites

• Functional validation:

  • Create site-directed mutants (phospho-mimetic or phospho-null)

  • Assess the impact of mutations on protein function, localization, or interactions

What are common challenges in working with recombinant Protein Asterix and how can they be addressed?

Common challenges and solutions:

• Protein stability issues:

  • Add stabilizing agents like trehalose (already in storage buffer at 6%)

  • Optimize buffer conditions (pH, salt concentration)

  • Add protease inhibitors during handling

  • Maintain appropriate temperature conditions

• Solubility problems:

  • Test different solubilization buffers

  • Consider adding detergents for membrane-associated proteins

  • Adjust salt concentration and pH

  • Use protein stabilizing agents

• Activity loss during storage:

  • Aliquot to avoid repeated freeze-thaw cycles

  • Add glycerol (5-50%) to prevent freezing damage

  • Store working aliquots at 4°C for short-term use (up to one week)

  • Consider flash-freezing in liquid nitrogen before -80°C storage

How can I verify the functional activity of Protein Asterix after purification?

Without specific information about Protein Asterix function, consider these general approaches:

• Binding assays:

  • If Protein Asterix has suspected binding partners, perform in vitro binding assays

  • Test interactions with potential nucleic acid targets if it has binding domains

  • Use surface plasmon resonance or other biophysical methods to characterize interactions

• Functional complementation:

  • Express recombinant Protein Asterix in knockout mutants

  • Assess restoration of phenotypes or molecular functions

  • Compare activity to native protein in wild-type plants

• Structural integrity assessment:

  • Use circular dichroism to analyze secondary structure

  • Apply thermal shift assays to assess protein stability

  • Consider limited proteolysis to verify proper folding

How can I integrate Protein Asterix data with broader Arabidopsis functional genomics datasets?

For integrating Protein Asterix data with broader datasets:

• Gene expression data integration:

  • Compare with publicly available RNA-seq datasets from Araport and other databases

  • Analyze co-expression patterns with known stress-responsive genes

  • Examine expression across different tissues, developmental stages, and stress conditions

• Protein interaction network analysis:

  • Integrate experimentally determined interactions into existing protein-protein interaction networks

  • Identify potential functional modules or pathways

  • Use tools like Cytoscape for network visualization and analysis

• Multi-omics data integration:

  • Combine transcriptomics, proteomics, and metabolomics data

  • Apply systems biology approaches to understand Protein Asterix function in broader cellular context

  • Use machine learning approaches to identify patterns across diverse datasets

What bioinformatic approaches can predict Protein Asterix function based on sequence and structural features?

For predicting Protein Asterix function:

• Sequence-based analysis:

  • Perform multiple sequence alignment with orthologs from other plant species

  • Identify conserved domains or motifs using tools like PROSITE, Pfam, or InterPro

  • Apply machine learning-based function prediction tools

• Structural prediction and analysis:

  • Generate protein structure predictions using AlphaFold or similar tools

  • Identify potential binding sites or functional regions

  • Compare structural features with proteins of known function

• Evolutionary analysis:

  • Conduct phylogenetic analysis to identify evolutionary relationships

  • Examine selective pressure on specific residues or domains

  • Compare with orthologs in other plant species to identify conserved features