Recombinant Arabidopsis thaliana Protein cornichon homolog 1 (At3g12180)

Shipped with Ice Packs
In Stock

Description

Introduction

The Arabidopsis thaliana genome encodes a variety of proteins involved in diverse cellular processes. Among these is a family of proteins known as Cornichon Homologs (CNIHs), which are key cargo receptors in the endoplasmic reticulum (ER) . This article focuses on Recombinant Arabidopsis thaliana Protein Cornichon Homolog 1 (At3g12180), exploring its structure, function, and significance in plant physiology.

General Information

Arabidopsis thaliana CNIH proteins, including AtCNIH1 (At3g12180), are localized to the early secretory pathway . There are five CNIH proteins identified in Arabidopsis thaliana, named AtCNIH1 through AtCNIH5 .

Molecular Function and Enzymatic Activity

At1g77540 adopts a fold similar to that of GCN5-related N-acetyltransferases . Enzymatic activity assays showed that At1g77540 has weak acetyltransferase activity against histones H3 and H4 . Chemical shift perturbations in 15N-HSQC spectra upon the addition of CoA indicated cofactor binding and identified its binding site . Further, the X-ray structure of the At1g77540–CoA complex elucidated the molecular details of this interaction .

CNIH as Cargo Receptors

CORNICHON HOMOLOG proteins (CNIHs) are conserved eukaryotic cargo receptors that facilitate the selective export of membrane proteins from the endoplasmic reticulum (ER) .

Homologs

Two homologous proteins, OsCNIH1 and OsCNIH2, have been identified in Oryza sativa .
OsCNIH1 interacts with the sodium transporter OsHKT1;3, suggesting it acts as a cargo receptor for OsHKT1;3 . In Arabidopsis, five CNIH proteins (AtCNIH1-AtCNIH5) have been identified, which are localized to the early secretory pathway .

Role in Pollen Tube Growth

Of the five Arabidopsis CNIHs, only cnih1, cnih4, and the cnih1/cnih4 double mutant showed reduced pollen tube tip Ca+2 fluxes with a wild-type-like growth rate .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
At3g12180; F28J15.3; Protein cornichon homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At3g12180
Target Protein Sequence
MAWDLFLWIVSFFVSLALVASVFYQVICLTDLEADYLNPFETSTRINRLVIPEFILQGSL CLLFLLTWHWVFFLVAVPVTVYHAMLYKERRYLIDVTEVFRGISFEKKLRYTKLGFYVFL FIMVVFRLTLSAVYSFTEDDDLLHLF
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G12180

STRING: 3702.AT3G12180.1

UniGene: At.39633

Protein Families
Cornichon family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Arabidopsis thaliana Protein Cornichon Homolog 1 (At3g12180)?

Arabidopsis thaliana Protein Cornichon Homolog 1 (At3g12180) is a member of the evolutionarily conserved cornichon family of proteins that function as cargo receptors in the secretory pathway of eukaryotic cells. In Arabidopsis, it is one of five identified cornichon homologs (AtCNIH1-AtCNIH5) that localize to the early secretory pathway . The full-length protein consists of 146 amino acids and contains characteristic domains that enable its function in protein trafficking between cellular compartments . CNIH1 plays a crucial role in the transport of specific cargo proteins from the endoplasmic reticulum (ER) to the Golgi apparatus, constituting an important component of cellular membrane organization and protein localization mechanisms in plants.

What conserved domains characterize At3g12180 and related cornichon proteins?

At3g12180 (CNIH1) contains several key conserved domains characteristic of the cornichon protein family:

  • The IFXXL sequence motif (represented as IFX/NL in plants), which is similar to the IFRTL domain found in other eukaryotes. This domain serves as an interaction site with the COPII component SEC24p in yeast and likely performs similar functions in plants .

  • An acidic domain that appears to be restricted to plant and fungal homologs. This region is particularly important as it functions as a binding site for cargo proteins .

  • While not specifically mentioned for At3g12180, cornichon proteins in Physcomitrium patens possess an extended C-terminus with multiple potential phosphorylation residues that may regulate protein function .

The presence of these conserved domains suggests that At3g12180 functions similarly to other cornichon proteins as a cargo receptor, facilitating the trafficking of specific proteins through the secretory pathway.

How is At3g12180 related evolutionarily to other cornichon proteins?

Evolutionary analysis of cornichon proteins reveals that they cluster into three main phylogenetic groups:

  • Group A: Exclusively contains cornichon homologs from chlorophyte algae

  • Group P: Comprises cornichon proteins from higher plants, including Arabidopsis CNIH proteins

  • Group F: Consists of fungal cornichon proteins

This phylogenetic organization suggests that plant cornichon proteins, including At3g12180, share more similarities with fungal homologs than with animal counterparts . The conservation of cornichon proteins across eukaryotes indicates their fundamental importance in cellular trafficking processes. Within Arabidopsis, At3g12180 is one of five cornichon homologs (AtCNIH1-AtCNIH5), suggesting functional diversification within the plant lineage . This evolutionary conservation and diversification pattern provides important context for understanding the specialized functions of At3g12180 in plant cellular processes.

What is the subcellular localization of At3g12180?

At3g12180 (CNIH1) primarily localizes to the early secretory pathway, particularly the endoplasmic reticulum (ER) and potentially the Golgi apparatus . This localization pattern is consistent with its function as a cargo receptor protein that facilitates protein trafficking between these compartments. In heterologous expression studies using tobacco leaf epidermis, cornichon proteins have been observed in reticulated structures resembling the ER as well as punctate structures distributed throughout the cytoplasm . The localization of cornichon proteins to these early secretory pathway compartments is evolutionarily conserved, as demonstrated by similar localization patterns reported for rice OsCNIH1, which localizes to both the ER and Golgi apparatus . This specific subcellular distribution is critical for the protein's function in facilitating the selective transport of cargo proteins from their site of synthesis to their ultimate cellular destination.

How does At3g12180 function in the secretory pathway?

At3g12180 functions as a cargo receptor in the plant secretory pathway, facilitating the selective transport of specific membrane proteins from the endoplasmic reticulum (ER) to the Golgi apparatus. The protein appears to be involved in the following processes:

  • Recognition and binding of specific cargo proteins in the ER membrane through its cargo-binding domain .

  • Recruitment of these cargo proteins into COPII vesicles through interaction with COPII components, likely via its IFXXL sequence motif .

  • Facilitating the proper trafficking and localization of these cargo proteins to their destination membranes, potentially including plasma membrane proteins .

While the specific cargo proteins that interact with At3g12180 in Arabidopsis have not been fully characterized in the provided search results, studies of cornichon homologs in other plants suggest they may be involved in trafficking various membrane proteins, including transporters . For example, OsCNIH1 in rice has been shown to interact with the sodium transporter OsHKT1;3, suggesting a role as a cargo receptor for this transporter . This fundamental role in protein trafficking positions At3g12180 as an important regulator of membrane protein composition and cellular polarity in plants.

What evidence exists for At3g12180's involvement in auxin transport?

While the direct evidence for At3g12180's specific involvement in auxin transport is limited in the provided search results, studies of cornichon proteins in the moss Physcomitrium patens provide insights into the potential role of cornichon homologs in auxin transport. In P. patens, CNIH2 functions as a specific cargo receptor for the auxin efflux carrier PINA, controlling its trafficking and membrane localization . The C-terminus of the CNIH2 protein is particularly important for this function, regulating the interaction with and plasma membrane localization of PINA .

Although the search results do not directly establish At3g12180's role in auxin transport in Arabidopsis, the evolutionary conservation of cornichon proteins suggests that At3g12180 might perform similar functions in flowering plants. In Arabidopsis, PIN proteins are key auxin efflux carriers that establish directional auxin flow, crucial for various developmental processes. If At3g12180 functions analogously to moss CNIH2, it could potentially be involved in regulating the trafficking and localization of PIN proteins or other auxin transporters in Arabidopsis, thereby influencing auxin-dependent developmental processes.

Further research specifically examining the interaction between At3g12180 and Arabidopsis PIN proteins would be necessary to conclusively establish its role in auxin transport.

What are the optimal expression systems for producing recombinant At3g12180?

Based on the available information, recombinant At3g12180 can be successfully expressed in E. coli expression systems . The search results indicate that commercially available recombinant full-length Arabidopsis thaliana Protein Cornichon Homolog 1 is produced in E. coli with a His-tag . This suggests that bacterial expression systems are viable for producing functional recombinant At3g12180.

For researchers seeking to express At3g12180, the following considerations are important:

  • Expression vector: Vectors compatible with E. coli expression that incorporate an appropriate tag (such as His-tag) for purification.

  • Protein length: The full-length protein (1-146 amino acids) appears to be expressible in bacterial systems .

  • Purification strategy: His-tagged purification approaches appear suitable for isolating the recombinant protein.

  • Alternative systems: While not explicitly mentioned in the search results, membrane proteins are sometimes better expressed in eukaryotic systems like yeast, insect cells, or plant-based expression systems, which might provide more appropriate post-translational modifications and membrane insertion capabilities.

For structural studies requiring high purity and yield, optimization of expression conditions (temperature, induction time, media composition) would be necessary to maximize protein production while maintaining proper folding.

What methods are most effective for studying protein-protein interactions involving At3g12180?

Based on the research methodologies described in the search results, several techniques have proven effective for studying protein-protein interactions involving cornichon proteins:

  • Mating-Based Split Ubiquitin System (mbSUS): This yeast-based technique is specifically designed for identifying interactions between membrane proteins, making it particularly suitable for studying At3g12180 interactions. The approach allows for semi-quantitative assessment of interaction strength through growth on selection media and inhibition tests .

  • Bimolecular Fluorescence Complementation (BiFC): This approach has been successfully employed to visualize interactions between cornichon proteins and their interacting partners in plant cells. When performed in heterologous systems like Nicotiana benthamiana epidermal cells, BiFC can provide spatial information about where these interactions occur within the cell .

  • Yeast Two-Hybrid Screening: While not specifically mentioned for At3g12180, this approach has been used to identify interacting partners of related cornichon proteins, such as the identification of BEH2 as an interaction partner of ASKtheta .

  • In Vitro and In Vivo Phosphorylation Assays: For studying specific regulatory mechanisms like phosphorylation, both in vitro and in vivo phosphorylation assays have been successfully applied to cornichon-related research .

When designing experiments to study At3g12180 interactions, researchers should consider using multiple complementary approaches to validate results, as each method has specific strengths and limitations when applied to membrane proteins.

What genetic approaches can be used to study At3g12180 function in planta?

Several genetic approaches have been successfully employed to study cornichon protein function in plants and could be applied to investigate At3g12180:

  • CRISPR-Cas9 Gene Editing: This technique has been used to generate mutations in cornichon genes in Physcomitrium patens, resulting in an in-frame premature stop codon that created a truncated, non-functional protein . This approach allows for precise gene modification while maintaining endogenous gene regulation.

  • Homologous Recombination: This approach has been used to generate complete gene replacements of cornichon genes with selection markers like hygromycin resistance cassettes . In Arabidopsis, this method might be less efficient but still applicable.

  • T-DNA Insertion Lines: While not specifically mentioned in the search results, T-DNA insertion collections are widely available for Arabidopsis and might include lines with insertions in At3g12180.

  • Reporter Fusion Constructs: Creating fusion proteins between At3g12180 and fluorescent proteins can help visualize its localization and trafficking in planta .

  • Double Mutant Analysis: Generating double mutants (e.g., cnih1/cnih2) can help reveal functional redundancy among cornichon family members .

  • Overexpression Studies: Constitutive or inducible overexpression of At3g12180 could reveal gain-of-function phenotypes, as demonstrated with other kinases in BR signaling pathways .

When implementing these approaches, it's important to include appropriate controls and perform complementation tests to confirm that observed phenotypes are specifically due to the manipulation of At3g12180.

How might phosphorylation regulate At3g12180 function?

While the search results don't specifically address phosphorylation of At3g12180, they provide insights from related cornichon proteins that suggest potential phosphorylation-based regulation mechanisms. In Physcomitrium patens, cornichon proteins possess an extended C-terminus with multiple putative phosphorylation residues . According to phosphorylation prediction using NetPhos3.1, CNIH1 in P. patens has three threonine residues (T145, T148, and T150) identified as potential phosphorylation sites .

This information suggests that At3g12180 might similarly be regulated by phosphorylation, potentially affecting:

  • Protein-protein interactions: Phosphorylation could modulate the ability of At3g12180 to interact with cargo proteins or COPII components.

  • Subcellular localization: Phosphorylation states might influence the trafficking of At3g12180 itself between cellular compartments.

  • Cargo selectivity: Different phosphorylation patterns could potentially alter the specificity or affinity of At3g12180 for different cargo proteins.

  • Response to signaling pathways: Phosphorylation could integrate At3g12180 function with broader cellular signaling networks, including hormone responses.

To investigate these possibilities, researchers could employ site-directed mutagenesis to create phospho-null (e.g., T→A) or phospho-mimetic (e.g., T→D/E) variants of At3g12180, and assess their function, localization, and interaction properties. Mass spectrometry approaches could also be used to identify in vivo phosphorylation sites under different conditions or developmental stages.

What is the relationship between At3g12180 and brassinosteroid signaling?

While the search results don't directly connect At3g12180 to brassinosteroid (BR) signaling, they provide information about BR signaling components that might help contextualize potential relationships. Brassinosteroids are plant hormones that regulate numerous processes including cell elongation, leaf development, pollen tube growth, and xylem differentiation . The BR signaling pathway involves:

  • BR perception by the BRI1 receptor complex

  • Involvement of GSK3/shaggy-like kinases (GSKs) as critical regulators of intracellular signaling

  • Phosphorylation of transcriptional regulators like BES1, BZR1, and BEH2

Considering that cornichon proteins function as cargo receptors in the secretory pathway, At3g12180 could potentially be involved in:

  • Trafficking of BR signaling components: At3g12180 might facilitate the proper localization of receptors, kinases, or other proteins involved in BR signaling.

  • Regulation of BR-responsive membrane proteins: BR signaling affects numerous cellular processes that involve membrane proteins, which might require At3g12180 for proper trafficking.

  • Integration of multiple signaling pathways: Given that auxin and BR signaling pathways often interact, At3g12180's potential role in auxin transport (inferred from cornichon studies in moss) might intersect with BR responses.

To investigate these possibilities, researchers could examine At3g12180 expression patterns in response to BR treatment, analyze potential interactions between At3g12180 and BR signaling components, and assess BR sensitivity in At3g12180 mutant plants.

What technical challenges exist in studying At3g12180 protein-protein interactions?

Studying protein-protein interactions involving At3g12180 presents several technical challenges that researchers should consider:

  • Membrane protein nature: As an integral membrane protein, At3g12180 contains hydrophobic domains that make it difficult to express, purify, and maintain in its native conformation in vitro. This complicates many traditional protein interaction assays .

  • Transient interactions: Cargo receptor interactions with their cargo proteins are often transient and condition-dependent, making them difficult to capture and study .

  • Redundancy with other CNIH proteins: Arabidopsis contains five CNIH proteins (AtCNIH1-5) with potentially overlapping functions, which may complicate genetic approaches and interpretation of phenotypes .

  • Subcellular compartment specificity: Interactions may occur only in specific cellular compartments or under specific conditions, requiring specialized approaches to detect .

  • Post-translational modifications: Interactions may be dependent on specific post-translational modifications (like phosphorylation) that are difficult to recapitulate in heterologous systems .

To address these challenges, researchers should consider using complementary approaches such as the mating-based split ubiquitin system specifically designed for membrane proteins, bimolecular fluorescence complementation in planta, co-immunoprecipitation with carefully designed controls, and proximity-based labeling techniques that can capture even transient interactions in their native cellular environment.

How do CNIH family members functionally differ in Arabidopsis?

Arabidopsis thaliana contains five cornichon homologs (AtCNIH1-AtCNIH5), all of which localize to the early secretory pathway . While the search results don't provide comprehensive information about the functional differences between these family members in Arabidopsis, they offer some insights:

  • AtCNIH1 and AtCNIH4: Mutations in these genes (either single mutants or the cnih1/cnih4 double mutant) showed reduced pollen tube tip Ca²⁺ fluxes while maintaining a wild-type-like growth rate . This suggests these particular family members may be involved in calcium signaling or homeostasis in pollen tubes.

  • Specialized functions: The presence of multiple CNIH genes in Arabidopsis suggests functional specialization, possibly involving different cargo specificities, expression patterns, or developmental contexts.

By comparison, studies in Physcomitrium patens, which has only two CNIH genes, revealed distinct functions:

  • CNIH1: Regulates positioning of branch initial cells in protonemata

  • CNIH2: Negatively regulates protonemal branching and influences cell differentiation from chloronemata to caulonemata, functioning as a specific cargo receptor for the auxin efflux carrier PINA

The moss studies suggest that different CNIH proteins might interact with distinct cargo proteins and influence different developmental processes. Similar functional specialization likely exists among the five Arabidopsis CNIH proteins, but detailed comparative studies would be needed to fully characterize these differences.

What are promising future research directions for At3g12180?

Based on the current understanding of At3g12180 and related cornichon proteins, several promising research directions emerge:

  • Comprehensive cargo identification: Employing proximity-based labeling or immunoprecipitation coupled with mass spectrometry to identify the full range of proteins that interact with At3g12180, providing insights into its specific cargo preferences.

  • Structure-function studies: Determining the three-dimensional structure of At3g12180, potentially in complex with cargo proteins, to understand the molecular basis of cargo recognition and selectivity.

  • Tissue-specific functions: Investigating the expression patterns and functions of At3g12180 in different tissues and developmental contexts to understand its specialized roles.

  • Relationship with hormone signaling: Exploring potential connections between At3g12180 and hormone signaling pathways, particularly auxin and brassinosteroid signaling, given the evidence from moss studies.

  • Regulatory mechanisms: Investigating how At3g12180 activity is regulated, including potential phosphorylation mechanisms, protein-protein interactions, or transcriptional regulation.

  • Comparative analysis with other CNIH proteins: Conducting systematic comparative studies of all five Arabidopsis CNIH proteins to understand their functional diversification and potential redundancy.

  • Biotechnological applications: Exploring whether manipulation of At3g12180 could be used to optimize protein secretion or membrane protein localization in plants for biotechnological purposes.

These research directions would contribute significantly to understanding not only the specific functions of At3g12180 but also broader principles of protein trafficking and membrane organization in plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.