Recombinant Arabidopsis thaliana Protein cornichon homolog 4 (At1g12390)

Shipped with Ice Packs
In Stock

Description

Introduction

CORNICHON (CNIH) proteins are a family of endoplasmic reticulum (ER) proteins that act as cargo receptors, crucial for the transport and sorting of membrane proteins . In Arabidopsis thaliana, five CNIH proteins (AtCNIH1-5) have been identified . AtCNIH4, encoded by the gene At1g12390, is a member of this family and plays a role in protein trafficking within plant cells .

General Features of CORNICHON Homologs

CNIH proteins share several characteristic features:

  • A conserved cornichon motif .

  • An "IFRTL"-like Sec24-interacting motif .

  • Localization to the early secretory pathway, specifically the endoplasmic reticulum (ER) and Golgi apparatus (GA) .

Expression of AtCNIH4

RNA expression analysis indicates that all five AtCNIHs are present in pollen, with AtCNIH4 showing the highest expression levels .

Interactions of AtCNIH4

  • AtCNIH4 and AtGLR3.3: AtCNIH4 interacts with AtGLR3.3, a glutamate receptor-like channel, suggesting its involvement in the trafficking and regulation of these channels .

  • AtCNIH4 and Pollen Tube Growth: Mutants lacking CNIH1, CNIH4, or both exhibit reduced pollen tube tip Ca+2 fluxes but maintain wild-type-like growth rates .

Role in Protein Sorting and Trafficking

CORNICHON proteins are essential for the sorting and trafficking of proteins from the ER . This has been confirmed for AtCNIHs, which function similarly to CORNICHON proteins in other species .

Functional Studies and Mutant Analysis

Studies using heterologous expression systems in yeast and tobacco leaves have shown that CNIH proteins like OsCNIH1 (from Oryza sativa) localize to the ER and GA and interact with sodium transporters, suggesting their role as cargo receptors .

KNS3 Homologs

Research has identified KNS THREE HOMOLOGS (KNSTH) 1 and 2 in Arabidopsis thaliana. KNSTH1 (At3g28720) and KNSTH2 (At4g16180) show sequence identity with KNS3 (At5G58100.1) and possess an N-terminal signal peptide and a C-terminal transmembrane domain, similar to KNS3 .

At1g77540: A Minimal Acetyltransferase

At1g77540, another protein in Arabidopsis thaliana, has been structurally characterized and found to possess acetyltransferase activity. It binds CoA and acetylates histones H3 and H4, albeit weakly . Structural analysis reveals it has a "minimal" acetyltransferase fold .

CNIHs and Phosphate Transporters

Arabidopsis thaliana CNIH5 (AtCNIH5) is induced by phosphate (Pi) starvation and interacts with AtPHT1;1 and PHOSPHATE TRANSPORTER TRAFFIC FACILITATOR1 (AtPHF1), facilitating the ER export of PHT1 transporters, which are crucial for Pi uptake .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for customer use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its implementation.
Synonyms
At1g12390; F5O11.11; Protein cornichon homolog 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g12390
Target Protein Sequence
MGDIWTWLISFFFLIALVGIIVYQLVCLADLEFDYINPYDSASRINSVVLPEFIVQGVLC VFYLLTGHWFMTLLCLPYLYYNFHLYSKRQHLVDVTEIFNLLNWEKKKRLFKLAYIVLNL FLTIFWMIYSALDDYED
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G12390

STRING: 3702.AT1G12390.1

UniGene: At.51586

Protein Families
Cornichon family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Protein cornichon homolog 4 (At1g12390) in Arabidopsis thaliana?

Protein cornichon homolog 4 (At1g12390) belongs to the evolutionary conserved CORNICHON HOMOLOG (CNIH) family in Arabidopsis thaliana. This protein consists of 137 amino acids and is identified in UniProt with the ID Q84W04 . CNIH proteins function as endoplasmic reticulum (ER) cargo receptors that mediate the selective export of membrane proteins from the ER to the Golgi apparatus . Based on functional analysis of other CNIH family members, At1g12390 likely plays a crucial role in protein trafficking and membrane protein localization in plant cells.

To study At1g12390 function, researchers typically use:

  • Loss-of-function mutants or CRISPR/Cas9 knockouts

  • Fluorescent protein fusions for subcellular localization studies

  • Co-immunoprecipitation for identifying interaction partners

  • Phenotypic analysis under various environmental conditions

How is recombinant At1g12390 protein expressed and purified?

The recombinant expression and purification of At1g12390 involves the following methodological approach:

  • Expression system: The protein is typically expressed in E. coli with an N-terminal His tag to facilitate purification .

  • Purification process:

    • Affinity chromatography using the His tag

    • Additional purification steps may include ion-exchange chromatography and size exclusion chromatography

    • The protein can be purified to >90% purity as determined by SDS-PAGE

  • Final preparation: The purified protein is provided as a lyophilized powder in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

For optimal yield and purity, researchers should consider:

  • Testing multiple E. coli strains (BL21(DE3), Rosetta, etc.)

  • Optimizing induction conditions (temperature, IPTG concentration, duration)

  • Adding solubility-enhancing tags if necessary

  • Including protease inhibitors during purification

What are the optimal storage and handling conditions for recombinant At1g12390?

For maintaining protein stability and activity, the following storage and handling protocols are recommended:

ParameterRecommendationNotes
Long-term storage−20°C/−80°CAliquoting essential to prevent freeze-thaw damage
Working storage4°CStable for up to one week
Reconstitution mediumDeionized sterile waterTo concentration of 0.1-1.0 mg/mL
Stabilizing agentGlycerol (5-50%)Default recommendation is 50% final concentration
Buffer compositionTris/PBS-based with 6% Trehalose, pH 8.0Maintains protein stability
Handling precautionBrief centrifugation before openingEnsures contents are at the bottom of the vial

Researchers should avoid repeated freeze-thaw cycles as this significantly reduces protein stability and activity . For experimental reproducibility, it's crucial to prepare consistent aliquots and maintain standardized handling protocols.

How does At1g12390 relate functionally to other CORNICHON HOMOLOG proteins?

Based on phylogenetic classification and functional studies, At1g12390 (AtCNIH4) relates to other CNIH proteins as follows:

CNIH ProteinClassification GroupKnown FunctionsReference
AtCNIH1Grouped with yeast Erv14/Erv15ER cargo receptor
AtCNIH2Same subfamily as AtCNIH4 and OsCNIH1ER cargo receptor
AtCNIH3Brassicaceae-specific paralogNot fully characterized
AtCNIH4 (At1g12390)Same subfamily as AtCNIH2 and OsCNIH1ER cargo receptor (presumed)
AtCNIH5 (AT4G12090)Brassicaceae-specific paralogPi starvation-inducible; mediates PHT1 trafficking

To experimentally determine At1g12390's specific function compared to other CNIHs:

  • Generate single and higher-order mutants of different CNIH genes

  • Perform complementation studies between family members

  • Compare expression patterns across tissues and in response to stimuli

  • Identify specific cargo proteins for each CNIH family member

What experimental approaches can be used to study At1g12390's role in membrane protein trafficking?

Investigating At1g12390's role in membrane protein trafficking requires a multi-faceted experimental approach:

  • Subcellular localization studies:

    • Generate fluorescent protein fusions (GFP/YFP-At1g12390)

    • Co-localize with established markers for ER, ER exit sites (ERES), Golgi, and plasma membrane

    • Use FRAP (Fluorescence Recovery After Photobleaching) to measure dynamics

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation with potential cargo proteins

    • Yeast two-hybrid screening to identify interactors

    • BiFC (Bimolecular Fluorescence Complementation) for in vivo confirmation

    • Proximity labeling (BioID/APEX) to identify proteins in the vicinity

  • Functional trafficking assays:

    • Measure plasma membrane abundance of candidate cargo proteins in wild-type vs. At1g12390 mutants

    • Visualize and quantify ERES formation using markers like AtSAR1A, AtSEC16A, and AtSEC24A

    • Analyze trafficking kinetics using secreted reporter proteins

  • Genetic approaches:

    • Generate and characterize knockout/knockdown lines

    • Create tissue-specific or inducible expression systems

    • Develop complementation lines with mutated versions to identify critical domains

  • Biochemical fractionation:

    • Compare membrane protein composition in different cellular compartments

    • Analyze post-translational modifications that might regulate trafficking

How might At1g12390 interact with the COPII vesicle trafficking machinery?

Based on studies of related CNIH proteins, At1g12390 likely interfaces with the COPII machinery through several mechanisms:

  • ER exit site localization: At1g12390 may localize to ERES, similar to AtCNIH5 which co-localizes with AtSAR1A/AtSEC16A/AtSEC24A-labeled ERES .

  • Direct interactions with COPII components: Potential interaction partners include:

    • SAR1 GTPase - controls vesicle formation initiation

    • SEC16 - organizes ERES architecture

    • SEC24 - major cargo recognition subunit

  • Cargo selection mechanisms: At1g12390 may:

    • Bind directly to membrane protein cargo

    • Facilitate cargo interaction with SEC24

    • Stabilize cargo-COPII complexes

  • Adaptor function: Possibly functions as an adaptor between cargo proteins and the COPII machinery, similar to p24 proteins.

To experimentally investigate these interactions:

  • Perform pull-down assays with purified recombinant At1g12390 and COPII components

  • Use split-GFP or FRET to detect interactions in vivo

  • Analyze COPII vesicle formation in the presence/absence of At1g12390

  • Examine the effects of dominant-negative COPII mutants on At1g12390 function

What approaches can identify membrane proteins that depend on At1g12390 for trafficking?

Identifying At1g12390-dependent cargo proteins requires systematic screening approaches:

  • Comparative proteomics:

    • Isolate plasma membrane fractions from wild-type and At1g12390 mutant plants

    • Perform quantitative proteomics (TMT or SILAC labeling)

    • Identify proteins with decreased plasma membrane abundance in mutants

  • Genetic interaction screening:

    • Cross At1g12390 mutants with mutants of candidate cargo proteins

    • Look for enhanced or suppressed phenotypes indicating functional relationships

  • Proximity-based identification:

    • Fuse At1g12390 with BioID or APEX2

    • Identify biotinylated proteins that physically interact with At1g12390

    • Filter for membrane proteins that might be cargo

  • Direct binding assays:

    • Express the cytosolic domains of candidate cargo proteins

    • Perform pull-down assays with purified At1g12390

    • Validate using surface plasmon resonance or microscale thermophoresis

  • In vivo trafficking assays:

    • Generate fluorescent fusions of candidate cargo proteins

    • Compare trafficking efficiency in wild-type versus At1g12390 mutant backgrounds

    • Quantify ER retention versus plasma membrane localization

How can structural studies of At1g12390 inform our understanding of cargo recognition?

Structural analysis of At1g12390 can provide crucial insights into its cargo recognition mechanisms:

  • Homology modeling approaches:

    • Use known structures of related proteins as templates

    • Predict cargo-binding domains and interaction surfaces

    • Generate testable hypotheses about binding specificity

  • Crystal structure determination:

    • Express and purify sufficient quantities of recombinant At1g12390

    • Screen crystallization conditions systematically

    • Consider approaches similar to those used for GLR3.2 LBD (1.58 Å resolution) :

      • Design constructs with flexible regions removed

      • Co-crystallize with binding partners or cargo peptides

      • Use vapor diffusion crystallization methods

  • Cryo-EM analysis:

    • Particularly useful for membrane protein complexes

    • May capture different conformational states

    • Can visualize larger complexes with COPII components

  • Site-directed mutagenesis validation:

    • Mutate residues predicted to be important for cargo binding

    • Test mutants for complementation of trafficking defects

    • Validate direct binding through in vitro assays

  • Molecular dynamics simulations:

    • Model protein-protein interactions in a membrane environment

    • Predict conformational changes upon cargo binding

    • Identify potential allosteric mechanisms

What is the biological significance of At1g12390 in plant stress responses?

While direct evidence for At1g12390's role in stress responses is limited in the provided search results, we can infer potential functions based on related proteins:

  • Nutrient stress adaptation:

    • AtCNIH5 is induced by phosphate starvation and regulates phosphate transporter trafficking

    • At1g12390 might similarly regulate transporters for other nutrients under deficiency conditions

  • Relationship to host-pathogen interactions:

    • Search result mentions bacterial cell wall decomposition mediating pattern-triggered immunity

    • At1g12390 could potentially regulate the trafficking of pattern recognition receptors or defense-related transporters

  • Abiotic stress signaling:

    • May facilitate plasma membrane localization of stress sensors or signaling components

    • Could be involved in hormone-mediated stress responses through regulation of hormone transporter trafficking

  • Growth adaptation under stress:

    • Might alter the cell surface proteome to optimize resource allocation during stress

    • Could facilitate rapid changes in plasma membrane composition in response to environmental cues

To examine these possibilities, researchers should:

  • Analyze At1g12390 expression patterns under various stress conditions

  • Compare wild-type and mutant plants for stress tolerance phenotypes

  • Identify stress-related proteins whose trafficking depends on At1g12390

  • Investigate potential transcriptional regulation of At1g12390 by stress-responsive transcription factors

What controls should be included when studying At1g12390 localization and function?

Robust experimental design for At1g12390 studies requires careful consideration of controls:

  • Subcellular localization experiments:

    • Positive controls: Include known ER membrane proteins and ERES markers

    • Negative controls: Use cytosolic GFP and markers for other compartments

    • Validation approach: Confirm localization using multiple independent methods:

      • Fluorescent protein fusions

      • Immunogold electron microscopy

      • Biochemical fractionation

  • Protein-protein interaction studies:

    • Self-activation controls: Test bait and prey constructs individually in Y2H

    • Non-specific binding controls: Use unrelated proteins of similar size/charge

    • Domain controls: Test individual domains to map interaction sites

    • In vivo validation: Confirm Y2H or in vitro interactions in planta

  • Functional assays:

    • Genetic complementation: Test if the phenotype can be rescued by the wild-type gene

    • Multiple alleles: Use at least two independent mutant lines

    • Tissue-specific expression: Control expression in specific tissues to isolate effects

    • Inducible systems: Use for potentially lethal manipulations

  • Recombinant protein studies:

    • Protein folding checks: Circular dichroism to verify secondary structure

    • Activity assays: Functional verification of purified protein

    • Stability controls: Test protein stability under experimental conditions

    • Tag-only controls: Ensure tags don't interfere with function

How can researchers resolve contradictory trafficking phenotypes in At1g12390 studies?

When confronted with contradictory trafficking phenotypes, use these systematic approaches to resolve discrepancies:

  • Genetic background analysis:

    • Sequence the entire At1g12390 locus in all plant lines

    • Check for additional T-DNA insertions or mutations

    • Perform complementation tests between contradictory lines

    • Create new null alleles using CRISPR/Cas9 for verification

  • Expression level considerations:

    • Quantify At1g12390 expression levels in different experiments

    • Test if phenotypes are dosage-dependent

    • Use inducible expression systems to create concentration gradients

    • Consider potential dominant-negative effects of overexpression

  • Cargo-specific effects:

    • Different cargo proteins may show different dependencies

    • Systematically test multiple cargo proteins

    • Consider redundancy with other CNIH family members

    • Examine cargo-specific binding affinities

  • Technical approach harmonization:

    • Standardize growth conditions and developmental stages

    • Use the same subcellular fractionation protocols

    • Apply consistent imaging and quantification methods

    • Develop clear criteria for scoring trafficking phenotypes

  • Collaborative validation:

    • Exchange biological materials between labs

    • Perform blind analyses of samples

    • Develop standardized assays for inter-laboratory comparisons

    • Consider environmental variables that might influence results

What are optimal approaches for measuring At1g12390 cargo selectivity in vivo?

To quantitatively assess cargo selectivity of At1g12390 in living plant cells:

  • Ratiometric imaging approaches:

    • Co-express fluorescently tagged candidate cargo proteins with different fluorophores

    • Calculate plasma membrane to internal fluorescence ratios

    • Compare these ratios between wild-type and At1g12390 mutant plants

    • Perform time-course imaging to capture trafficking dynamics

  • Photoconvertible/photoactivatable tracking:

    • Tag cargo proteins with photoconvertible fluorescent proteins (e.g., Dendra2)

    • Photoconvert proteins in the ER

    • Track their movement to the plasma membrane over time

    • Compare trafficking rates between different cargo proteins

  • Quantitative proteomics workflow:

    • Isolate plasma membrane fractions using two-phase partitioning

    • Perform SILAC or TMT labeling for quantitative comparison

    • Compare wild-type, knockout, and complemented plants

    • Calculate enrichment/depletion ratios for all membrane proteins

  • Cargo competition assays:

    • Co-express multiple candidate cargo proteins

    • Artificially increase expression of one cargo

    • Observe effects on trafficking of other cargo proteins

    • Identify hierarchies of cargo preference

  • RUSH system adaptation:

    • Adapt the Retention Using Selective Hooks (RUSH) system for plants

    • Create conditional release of cargo from the ER

    • Measure kinetics of transport for different cargo proteins

    • Compare release kinetics in the presence/absence of At1g12390

What specialized techniques are required for studying At1g12390 in the context of membrane microdomains?

Investigating At1g12390's potential role in organizing or trafficking to membrane microdomains requires specialized approaches:

  • Membrane isolation techniques:

    • Detergent-resistant membrane (DRM) isolation

    • Density gradient centrifugation to separate membrane domains

    • Free-flow electrophoresis for membrane separation

    • Native extraction methods to preserve microdomain integrity

  • Advanced microscopy methods:

    • Super-resolution microscopy (PALM/STORM) for nanoscale localization

    • Fluorescence correlation spectroscopy (FCS) to measure diffusion rates

    • Single-particle tracking of cargo proteins in different membrane regions

    • FRET analysis to detect protein proximity within microdomains

  • Lipid interaction analysis:

    • Lipidomics analysis of membrane fractions

    • Lipid-protein overlay assays with purified At1g12390

    • In vitro reconstitution with defined lipid compositions

    • Fluorescently labeled lipid analogs to track domain formation

  • Domain disruption experiments:

    • Methyl-β-cyclodextrin treatment to disrupt sterol-rich domains

    • Temperature manipulation to alter domain fluidity

    • Genetic manipulation of lipid biosynthesis

    • Application of osmotic stress to alter membrane properties

  • Biophysical measurements:

    • Atomic force microscopy of membrane patches

    • Laurdan fluorescence to measure membrane order

    • Electron paramagnetic resonance (EPR) with spin-labeled lipids

    • Neutron reflectometry to characterize membrane structure

How can researchers accurately quantify the impact of At1g12390 on protein trafficking kinetics?

For precise quantification of At1g12390's effects on trafficking kinetics:

  • Pulse-chase approaches:

    • Use photoconvertible fluorescent proteins fused to cargo

    • Photoconvert proteins in the ER at a defined timepoint (pulse)

    • Track appearance at the plasma membrane over time (chase)

    • Calculate half-times for ER-to-PM transport

  • FRAP-based quantification:

    • Photobleach regions of the ER containing cargo proteins

    • Measure recovery kinetics as indication of mobility

    • Compare recovery curves between wild-type and At1g12390 mutants

    • Model diffusion constants and binding parameters

  • Secretion assays:

    • Use secreted luciferase as reporter

    • Measure appearance in medium over time

    • Calculate secretion rates and efficiency

    • Compare kinetics with different cargo proteins

  • Quantitative image analysis workflow:

    • Develop automated segmentation of cellular compartments

    • Track cargo intensity in each compartment over time

    • Generate compartment-specific intensity profiles

    • Fit data to trafficking models to extract rate constants

  • Synchronization strategies:

    • Temperature blocks to accumulate cargo in the ER

    • Drug treatments to temporarily block specific trafficking steps

    • Inducible expression systems for temporal control

    • Release from blocks to create synchronized trafficking waves

How should researchers interpret differences in trafficking phenotypes between related CNIH family members?

When comparing trafficking phenotypes between At1g12390 and other CNIH proteins (such as AtCNIH5 ), consider these analytical frameworks:

  • Evolutionary context analysis:

    • Examine phylogenetic relationships between CNIH proteins

    • Consider that AtCNIH3 and AtCNIH5 are Brassicaceae-specific paralogs

    • While AtCNIH2 and AtCNIH4 belong to the same subfamily as rice OsCNIH1

    • Evaluate whether differences reflect functional divergence or specialization

  • Expression pattern comparison:

    • Analyze tissue-specific and developmental expression patterns

    • AtCNIH5 is expressed in outer root cell layers above the meristem

    • Determine if At1g12390 shows complementary or overlapping expression

    • Consider potential redundancy in co-expressed regions

  • Cargo specificity assessment:

    • AtCNIH5 interacts with AtPHT1;1 and PHOSPHATE TRANSPORTER TRAFFIC FACILITATOR1

    • Systematically test multiple cargo proteins with different CNIH family members

    • Develop a matrix of CNIH-cargo interactions

    • Identify shared versus exclusive cargo relationships

  • Structural determinants analysis:

    • Compare protein sequences to identify conserved and divergent domains

    • Create chimeric proteins to map cargo recognition domains

    • Use structural modeling to predict interaction interfaces

    • Validate through site-directed mutagenesis

  • Higher-order mutant analysis:

    • Generate double/triple mutants between related CNIH genes

    • Quantify additive, synergistic, or epistatic effects

    • Test complementation with heterologous CNIH proteins

    • Evaluate functional conservation across species

What statistical approaches are most appropriate for analyzing At1g12390 trafficking data?

Robust statistical analysis of trafficking data requires careful consideration of appropriate methods:

  • Quantitative microscopy data:

    • Use mixed-effects models to account for cell-to-cell variability

    • Apply bootstrap resampling for confidence interval estimation

    • Perform power analysis to determine required sample sizes

    • Consider Bayesian approaches for complex trafficking models

  • Membrane protein abundance measurements:

    • Apply appropriate normalization to total protein or specific markers

    • Use ANOVA with post-hoc tests for multiple condition comparisons

    • Consider non-parametric tests if normality assumptions are violated

    • Implement false discovery rate correction for proteomics datasets

  • Time-series kinetic analysis:

    • Fit data to appropriate mathematical models (exponential, sigmoidal)

    • Extract rate constants and half-times

    • Compare models using Akaike Information Criterion

    • Apply repeated measures ANOVA for time-course experiments

  • Colocalization analysis:

    • Calculate Pearson's or Manders' coefficients for quantification

    • Apply appropriate thresholding methods

    • Use Costes randomization to establish significance

    • Consider object-based colocalization for discrete structures

  • Reproducibility considerations:

    • Perform biological replicates (different plants/transformations)

    • Implement blind quantification where possible

    • Pre-register analysis workflows before data collection

    • Share raw data and analysis code for transparency

How can researchers resolve conflicts between in vitro binding and in vivo trafficking results?

When in vitro binding studies with recombinant At1g12390 appear inconsistent with in vivo trafficking observations:

  • Biochemical context reconsideration:

    • Evaluate buffer conditions that might affect binding

    • Test binding in the presence of membrane mimetics

    • Consider post-translational modifications present in vivo but not in vitro

    • Assess the impact of protein tags on binding properties

  • Complex formation analysis:

    • In vivo, At1g12390 may function in multi-protein complexes

    • Identify additional complex components through proteomics

    • Reconstitute minimal complexes in vitro

    • Test if additional proteins modulate binding specificity

  • Temporal and spatial regulation:

    • Consider compartment-specific conditions (pH, ion concentrations)

    • Evaluate temporal regulation of interactions

    • Test if cargo engagement is sequential or cooperative

    • Examine if different cellular environments affect interactions

  • Functional validation approaches:

    • Create mutations that specifically disrupt binding

    • Test these mutations in both in vitro and in vivo systems

    • Develop structure-based hypotheses for discrepancies

    • Design experiments to directly test these hypotheses

  • System reconciliation strategies:

    • Develop intermediate complexity systems (semi-in vitro)

    • Use permeabilized cell systems

    • Create synthetic membrane systems with purified components

    • Develop cell-free expression systems with microsomes

What are the implications of At1g12390 research for our understanding of plant membrane trafficking?

Research on At1g12390 has several important implications for plant cell biology:

  • Cargo-selective trafficking mechanisms:

    • Plants have evolved specialized trafficking pathways for different cargo proteins

    • CNIH proteins like At1g12390 likely represent key components for selective export

    • This selectivity allows for precise regulation of the plasma membrane proteome

    • Understanding this selectivity is crucial for engineering membrane composition

  • Plant-specific adaptations:

    • The expansion of the CNIH family in plants (AtCNIH1-5) suggests specialization

    • Brassicaceae-specific paralogs indicate recent evolutionary adaptations

    • These adaptations may reflect responses to specific environmental challenges

    • Study of At1g12390 can reveal plant-specific innovations in the secretory pathway

  • Integration with stress response networks:

    • Related protein AtCNIH5 is involved in phosphate starvation responses

    • At1g12390 may similarly link environmental sensing to membrane composition

    • This integration represents a fundamental mechanism for plant adaptation

    • Trafficking regulation provides rapid modulation of transport capacity

  • Hierarchical organization of trafficking:

    • CNIH proteins may establish hierarchies of cargo export

    • This organization allows prioritization of essential proteins under stress

    • Understanding these hierarchies could explain coordinated membrane remodeling

    • May reveal fundamental principles of trafficking regulation

  • Evolutionary perspectives:

    • Comparison with yeast Erv14/Erv15 and animal CNIH proteins reveals conserved mechanisms

    • Plant-specific innovations highlight unique aspects of plant cell biology

    • Cross-kingdom studies can identify fundamental principles of cargo selection

    • May reveal ancient origins of selective membrane trafficking

What emerging technologies could enhance future studies of At1g12390?

Several cutting-edge technologies show promise for advancing At1g12390 research:

  • Advanced imaging approaches:

    • Lattice light-sheet microscopy for long-term, low-phototoxicity imaging

    • Super-resolution microscopy (PALM/STORM) for nanoscale localization

    • Correlative light and electron microscopy (CLEM) to combine functional and ultrastructural data

    • Expansion microscopy to physically enlarge specimens for improved resolution

  • Genome editing innovations:

    • Prime editing for precise mutations without double-strand breaks

    • Base editing for targeted point mutations

    • Multiplexed CRISPR systems for simultaneous manipulation of multiple CNIH genes

    • Inducible degradation systems for temporal control of protein function

  • Proteomics advances:

    • Proximity labeling with improved enzymes (TurboID, miniTurbo)

    • Crosslinking mass spectrometry to capture transient interactions

    • Single-cell proteomics to reveal cell-specific trafficking patterns

    • Targeted proteomics for accurate quantification of low-abundance membrane proteins

  • Structural biology tools:

    • Cryo-electron tomography of cellular sections

    • Integrative structural biology combining multiple data types

    • AlphaFold2 predictions combined with experimental validation

    • Time-resolved structural studies to capture trafficking intermediates

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Network analysis to position At1g12390 in trafficking pathways

    • Computational modeling of membrane trafficking dynamics

    • Machine learning for image analysis and phenotype prediction

How might findings from At1g12390 research be applied to crop improvement strategies?

Knowledge gained from At1g12390 studies has potential applications in agriculture:

  • Nutrient uptake enhancement:

    • AtCNIH5 enhances phosphate transporter targeting and phosphate uptake

    • At1g12390 might similarly regulate other nutrient transporters

    • Engineering CNIH expression could enhance nutrient acquisition efficiency

    • This could reduce fertilizer requirements while maintaining productivity

  • Stress tolerance improvement:

    • Modulating At1g12390 expression might enhance trafficking of stress-response proteins

    • This could improve plant resilience to drought, salinity, or temperature extremes

    • Targeted enhancement in specific tissues could optimize resource allocation

    • Could extend crop growth ranges into marginal lands

  • Pathogen resistance strategies:

    • If At1g12390 regulates immune receptor trafficking, it could be targeted to enhance immunity

    • This approach might provide broad-spectrum disease resistance

    • Could reduce reliance on chemical pesticides

    • Might offer more durable resistance than single resistance genes

  • Biotechnology applications:

    • Knowledge of cargo selection principles could improve heterologous protein production

    • Could enhance surface expression of engineered proteins in crop plants

    • Might improve production of valuable proteins in plant biofactories

    • Could facilitate development of plants as biosensors

  • Developmental optimization:

    • Tissue-specific modulation of At1g12390 could alter local protein compositions

    • This might allow fine-tuning of growth patterns or resource allocation

    • Could enhance specific developmental processes like seed filling or fruit ripening

    • Might improve harvest index or yield stability under variable conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.