Recombinant Arabidopsis thaliana Protein CPR-5 (CPR5)

Shipped with Ice Packs
In Stock

Description

Biological Functions and Mechanisms

CPR5 regulates diverse processes in Arabidopsis, acting as a master regulator of redox balance, hormone signaling, and stress responses.

Key Roles

  1. Defense and Senescence Regulation

    • Negative regulator of pathogen response: Suppresses constitutive expression of salicylic acid (SA)- and jasmonic acid (JA)-dependent defense genes (e.g., PR genes, PDF1.2) .

    • Senescence modulation: Promotes leaf senescence at late developmental stages while supporting early growth .

  2. Hormone and Stress Signaling

    • Hypersensitivity to hormones: Mutants (cpr5) show heightened sensitivity to ethylene, ABA, and sugars .

    • Unfolded Protein Response (UPR) modulation: Interacts with UPR transducers (e.g., bZIP60, bZIP28) to balance growth and ER stress .

  3. Ion Homeostasis

    • Potassium (K⁺) regulation: Loss-of-function cpr5 mutants exhibit reduced leaf K⁺ (10–30% decrease) due to altered expression of Cyclic Nucleotide Gated Channels (CNGCs) and HAK5 (root K⁺ transporter) .

ProcessCPR5 RoleAssociated Genes/Pathways
DefenseRepresses SA/JA pathwaysPR genes, PDF1.2
SenescenceAccelerates leaf senescenceHYS1 (hypersenescence)
K⁺ HomeostasisRegulates shoot-to-root K⁺ export via CNGCsCNGC10, CNGC11, CNGC12, HAK5
UPRAntagonizes SA-dependent growth inhibitionbZIP60, bZIP28

Cellular Localization and Protein Interactions

  • Nuclear and membrane localization: CPR5 shuttles between the nucleus and membrane, with potential proteolytic cleavage releasing a nucleosolic domain .

  • RNA-binding activity: Identifies as an RNA-binding protein (Tra2 subfamily) that interacts with splicing factors (e.g., NineTeen Complex) and polyadenylation machinery (e.g., CPSF) .

Downstream Signaling

  • Redox regulation: Maintains oxidative stress balance by modulating ROS-scavenging enzymes (e.g., glutathione S-transferases) .

  • Alternative splicing: Regulates splicing of immune-related genes, such as ARGONAUTE1 (AGO1) .

Key Studies

Study FocusFindingsCitation
K⁺ Deficiency in cpr5cpr5 mutants show reduced leaf K⁺ due to elevated CNGC expression in shoots and downregulated HAK5 in roots .
UPR and Growth-Defense TradeoffsCPR5 inhibits SA-dependent UPR activation, promoting growth under stress .
RNA ProcessingCPR5 binds RNA and coordinates with CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR (CPSF) to modulate splicing .

Mutant Phenotypes

  • Pleiotropic effects: cpr5 mutants exhibit spontaneous cell death, defective trichomes, and reduced fecundity .

  • Grafting experiments: Shoot-derived cpr5 alleles primarily drive K⁺ deficiency (74% contribution), with root alleles contributing 19% .

Applications and Future Directions

  • Agricultural research: Targeting CPR5 to optimize stress tolerance and nutrient efficiency in crops.

  • Molecular tools: Recombinant CPR5 is used to study RNA-protein interactions and UPR mechanisms in vitro .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
CPR5; HYS1; At5g64930; MXK3.16; Protein CPR-5; Protein constitutive expression of pathogenesis-related genes 5; Protein constitutive expression of PR genes 5; Protein hypersenescence-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-564
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CPR5
Target Protein Sequence
MEALLLPPSPEPQNQITNPANSKPNHQSGDVHKDETMMMKKKKDTNPSNLEKRKLKGKKK EIMDNDEASSSYCSTSSTSNSNSTKRVTRVVHRLRNPMRLGMARRSVGERQAEKLAKPLG FSLAAFANMVIARKNAAGQNVYVDDLVEIFATLVEESLANVYGNKLGSFATNFEQTFSST LKILKLTNECANPHQSNNNDGGSCNLDRSTIDGCSDTELFERETSSATSAYEVMQGSATA TSLMNELALFEETLQLSCVPPRSSAMALTTDERFLKEQTRANDLKTVEIGLQIRELRCKE TALGLKFESNNLGKAALELDVSKAAFRAEKFKTELEDTRKEEMVTRIMDWLLVSVFSMLA SMVLGVYNFSIKRIEDATSVCDQSEEKSSSWWVPKQVSSINSGFNTFICRVRVWVQIFFG VLMIIVFTYFLNKRSSGTKQTMPISFIVLFLGIFCGVSGKLCVDTLGGDGKLWLIVWEVF CLLQFVANVFTLALYGLMFGPINVTQETRSNRCNSMFPYWARRSVVYVVILFVLPVINGL LPFATFGEWRDFAMYHLHGGSDYA
Uniprot No.

Target Background

Function
CPR-5 (CPR5) is a protein in Arabidopsis thaliana that is believed to play a role in transcriptional processes. It negatively regulates senescence and chlorotic lesions induced by biotic (e.g., pathogens) and abiotic (e.g., sugars, darkness) agents, likely by controlling programmed cell death (PCD). CPR5 acts as a negative regulator of plant PCD and effector-triggered immunity (ETI). It promotes cell division and endoreduplication (e.g., in trichomes).
Gene References Into Functions
  1. Increased levels of endogenous salicylic acid (SA) render cpr5 growth insensitive to unresolved endoplasmic reticulum (ER) stress. PMID: 27747970
  2. GeBP/GPLs regulate a set of genes that represents a subset of the CPR5 pathway. PMID: 21875893
  3. Findings suggest that CPR5 plays a regulatory role in seed germination and early seedling growth through ABA and LOX pathways independently. PMID: 21556325
  4. CPR5 exhibits early-life beneficial effects by suppressing cell death and ensuring normal plant development, but it has late-life deleterious effects by promoting developmental senescence. PMID: 18033818
  5. CPR5 is unlikely to be a specific regulator of pathogen response pathways or senescence but rather functions in cell wall biogenesis or multiple cell signaling or transcription response pathways. PMID: 18485217
  6. CPR5 plays a critical role in regulating redox balance in Arabidopsis. PMID: 18721314

Show More

Hide All

Database Links

KEGG: ath:AT5G64930

STRING: 3702.AT5G64930.1

UniGene: At.7852

Subcellular Location
Membrane; Multi-pass membrane protein. Nucleus membrane.
Tissue Specificity
Ubiquitous.

Q&A

What is CPR5 and what are its key structural features?

CPR5 is a plant-unique transmembrane nucleoporin that plays critical roles in multiple cellular processes. Structurally, it contains an amino-terminal bipartite nuclear localization signal and five transmembrane domains (TMDs) at the carboxy terminus . The protein is exclusively associated with the endomembrane system, including the nuclear envelope (NE) and endoplasmic reticulum (ER)-associated large granules . Bioinformatic analysis reveals that Arabidopsis thaliana CPR5 has four exons, with EXON2 and EXON3 showing remarkable conservation across diverse plant species . The protein architecture suggests it functions as a transmembrane nucleoporin anchored at the equatorial plane of the nuclear pore complex (NPC) by its C-terminal TMDs, with its soluble N-terminus physically interacting with the NPC core scaffold .

How is CPR5 evolutionarily conserved across plant species?

CPR5 is an ancient, plant-unique gene found in higher plants as well as mosses (Physcomitrella patens) that diverged from plants approximately 400 million years ago . Phylogenetic analysis suggests CPR5 originated from P. patens or M. polymorpha, then diverged into branches of Gymnospermae (largely extinct during the Jurassic period) before angiosperms became dominant . Within angiosperms, the evolutionary trajectory appears to show Gnetopsida diverging into Amborella trichopoda, which then formed Magnoliales and eudicots . The high conservation of EXON3 compared to other exons suggests selective pressure maintaining this region, potentially indicating it contains a functional RNA binding domain (RBD) .

What are the primary phenotypes associated with cpr5 mutations?

The cpr5 mutations display numerous pleiotropic phenotypes, indicating CPR5's essential functions in plant biology. These phenotypes include:

Phenotypic CategorySpecific Manifestations
Immunity-relatedEnhanced constitutive expression of PR genes; Elevated salicylic acid and jasmonic acid levels; Enhanced disease resistance
Hormonal responsesHypersensitivities to sugar, ABA, ethylene, and jasmonic acid
DevelopmentDefective cell proliferation, endoreduplication, and trichome development; Reduced plant growth and reproduction fecundity
Cell deathAccelerated leaf senescence; Spontaneous lesion mimic cell death

These diverse phenotypes suggest that CPR5 functions at the nexus of multiple signaling pathways in plant cells .

How does CPR5 regulate nucleocytoplasmic transport at the molecular level?

CPR5 functions as a novel transmembrane nucleoporin that physically associates with the NPC core scaffold and participates in regulating the selective barrier function of nuclear pores . Proteomic analysis has identified interactions between CPR5 and key NPC components, particularly nucleoporin 155 (Nup155), a core scaffold component, and the IRC-associated linker nucleoporin Nup93a through its N-terminus .

CPR5 regulates nuclear transport by constraining nuclear access of signaling cargos. Experimental evidence shows that overexpressing wild-type CPR5 causes substantial cytoplasmic retention of stress- and hormone-related nuclear proteins including NPR1, JAZ1, and ABI5 . This activity appears specific to functional CPR5, as neither the NE protein WIT1, Nup155, nor a mutant form of CPR5 (G420D) could reproduce this effect .

Upon activation by immunoreceptors, CPR5 undergoes a critical oligomer-to-monomer conformational switch, which coordinates release of Cyclin-dependent Kinase Inhibitors (CKIs) for ETI signaling and reconfigures the selective barrier to allow significant influx of nuclear signaling cargos through the NPC .

What is the relationship between CPR5 and reactive oxygen species (ROS) signaling?

Transcriptomic and proteomic analyses of pre-symptom cpr5 mutants reveal that they experience high cellular oxidative stress . Three of the five universal ROS marker genes, 16 of the 27 genes induced by six ROS treatments, and one-third of the ROS-dependent putative transcription factors were upregulated in cpr5 mutants . At the protein level, members of the detoxifying enzyme family of glutathione S-transferases (GSTs) exhibited increased abundance . Direct detection using nitro blue tetrazolium staining confirmed elevated ROS presence in cpr5 mutants .

These findings suggest CPR5 functions as a master regulator of cellular ROS status and/or signaling, with complex interactions with other signaling networks to control multiple cellular processes including:

  • Cell proliferation, endoreduplication, and trichome development

  • Responses to ethylene, sugar, jasmonic acid, and ABA

  • Cell death and senescence regulation

  • Disease resistance mechanisms

The ROS regulatory function may explain the pleiotropic nature of cpr5 phenotypes, as ROS are known to participate in numerous signaling pathways affecting growth, development, hormone responses, and stress adaptation .

How does CPR5 function change throughout plant development?

CPR5 transcript is constitutively expressed throughout the plant but increases in levels during late development . Functional studies indicate that CPR5 has age-dependent roles: it is important for early plant growth but promotes senescence at late development stages . This biphasic activity pattern aligns with predictions from the Evolutionary Theory of Senescence derived from animal aging studies .

The developmental transition in CPR5 function represents a fascinating example of antagonistic pleiotropy, where the same gene has beneficial effects early in life but detrimental effects later. This concept helps explain the evolution of senescence as a natural developmental program rather than simply as deterioration .

What approaches can be used to produce and purify recombinant CPR5 protein?

Producing functional recombinant CPR5 presents unique challenges due to its transmembrane domains. Based on current research methodologies:

  • Expression system selection: E. coli systems may be suitable for expressing soluble domains (particularly the N-terminal region), while eukaryotic systems like yeast, insect cells, or plant-based expression systems are preferable for full-length protein that requires proper membrane insertion.

  • Construct design considerations:

    • Create truncated versions (CPR5-N containing only the N-terminal portion, or CPR5-C with the transmembrane domains) for domain-specific studies

    • Include affinity tags (His, FLAG, or YFP) for purification and visualization

    • Consider codon optimization for the expression system

  • Purification strategy:

    • For membrane-integrated full-length CPR5, use detergent-based extraction (mild non-ionic detergents like DDM or CHAPS)

    • For soluble domains, standard affinity chromatography followed by size exclusion

  • Functional validation:

    • Verify proper folding through circular dichroism

    • Assess membrane integration through protease protection assays

    • Confirm interaction with known binding partners (e.g., Nup155, Nup93a) through pull-down experiments

Research has successfully employed YFP-tagged CPR5 constructs for affinity purification and subsequent mass spectrometry analysis to identify interaction partners .

What genetic approaches are most effective for studying CPR5 function in planta?

Several genetic approaches have proven valuable for investigating CPR5 function:

  • Mutant analysis: Multiple cpr5 alleles have been identified through various screens, including those for enhanced disease resistance, altered trichome development, dark-induced senescence (hys1 alleles), and ethylene-induced senescence (old1 alleles) . These mutants provide valuable tools for studying CPR5's diverse functions.

  • Overexpression studies: Constitutive or inducible overexpression of CPR5 or its domains can reveal gain-of-function phenotypes. For example, overexpression of the CPR5-C domain leads to tissue collapse similar to ETI-associated programmed cell death, while full-length CPR5 overexpression causes cytoplasmic retention of nuclear signaling proteins .

  • Domain-specific expression: Expressing specific domains (e.g., CPR5-N or CPR5-C) can elucidate their distinct functions. The CPR5-C-induced PCD phenotype was suppressible by simultaneous overexpression of full-length CPR5 but not CPR5-N, suggesting competitive interference with endogenous CPR5 function .

  • Developmental regulation: Employing inducible promoters for knock-down or overexpression of CPR5 at specific developmental stages can reveal how its function changes during the plant life cycle .

  • Genetic interaction studies: Creating double mutants between cpr5 and other pathway components can reveal functional relationships. For example, double mutants between cpr5 and the ORC nucleoporins (nup85, nup96, and nup160) result in embryonic or seedling lethality, indicating their synergistic roles in maintaining NPC structural integrity .

What techniques are recommended for studying CPR5's role in nucleocytoplasmic transport?

To investigate CPR5's function in nucleocytoplasmic transport:

  • Nuclear transport assays:

    • Employ fluorescently tagged nuclear cargos (NPR1, JAZ1, ABI5) to monitor their localization in CPR5 wild-type, mutant, or overexpression backgrounds

    • Use nuclear import inhibitors to compare with CPR5-mediated transport inhibition

    • Quantify nuclear/cytoplasmic distribution ratios

  • Interaction studies:

    • Bimolecular Fluorescence Complementation (BiFC) assays to visualize CPR5 interactions with NPC components in situ

    • Co-immunoprecipitation followed by mass spectrometry to identify CPR5-associated protein complexes

    • In vitro pull-down assays to confirm direct physical interactions

  • Conformational analysis:

    • Study the oligomer-to-monomer switch in response to immunoreceptor activation

    • Use crosslinking approaches to capture different oligomeric states

    • Employ fluorescence resonance energy transfer (FRET) to monitor conformational changes in real-time

  • Functional assessment:

    • Develop in vitro nuclear transport assays using isolated nuclei

    • Create chimeric proteins by domain swapping to identify regions critical for transport regulation

    • Design reporter systems to quantitatively measure nuclear transport efficiency

These methods have revealed that CPR5 associates with NPC anchors to constrain nuclear access of signaling cargos and sequesters Cyclin-dependent Kinase Inhibitors involved in ETI signal transduction .

How can researchers distinguish direct versus indirect effects of CPR5 mutation?

Distinguishing direct from indirect effects in CPR5 research requires:

  • Temporal analysis: Examine the earliest detectable molecular changes in inducible CPR5 knockdown or overexpression systems to identify primary effects before secondary responses occur.

  • Tissue-specific studies: Use tissue-specific promoters to manipulate CPR5 expression in distinct cell types to determine where its activity is primarily required.

  • Domain-specific mutants: Create targeted mutations in specific CPR5 functional domains rather than complete knockouts to separate distinct functions.

  • Molecular signatures: Compare transcriptomic and proteomic profiles of pre-symptomatic cpr5 mutants with profiles from other mutants affecting related pathways to identify CPR5-specific signatures .

  • Multi-dimensional data analysis: Employ principal component analysis or other dimensionality reduction techniques to identify patterns in large datasets that might distinguish primary from secondary effects.

For example, researchers have successfully used pre-symptom cpr5 mutants to detect early ROS-related transcriptomic changes, revealing CPR5's direct role in ROS homeostasis before secondary developmental effects manifest .

What are the current controversies or unresolved questions regarding CPR5 function?

Several key questions remain unresolved in CPR5 research:

  • Subcellular localization: While CPR5 has been localized to the endomembrane system including nuclear envelope, its precise localization within the NPC and potential dynamic redistribution during signaling require further clarification .

  • Mechanism of action: The exact biochemical mechanism by which CPR5 regulates nucleocytoplasmic transport and ROS signaling remains incompletely understood. Whether CPR5 functions primarily as a scaffold, a gate, or possesses enzymatic activity is unclear.

  • Regulatory control: How CPR5 itself is regulated at transcriptional, translational, and post-translational levels, particularly during developmental transitions or in response to stress, remains to be fully elucidated.

  • Evolutionary divergence: While CPR5 is conserved across plants, how its functions might have specialized or diversified in different plant lineages is not well characterized.

  • Integration with other pathways: How CPR5-mediated regulation coordinates with other cellular signaling pathways, particularly hormone signaling networks, remains to be systematically mapped.

Addressing these questions will require integrative approaches combining structural biology, live-cell imaging, systems biology, and comparative genomics .

What emerging technologies might advance CPR5 research?

Several cutting-edge technologies hold promise for deepening our understanding of CPR5:

  • Cryo-electron microscopy: To determine the structural organization of CPR5 within the nuclear pore complex and capture different conformational states.

  • Single-molecule imaging: To visualize CPR5 dynamics and interactions in living cells with unprecedented resolution.

  • Proximity labeling approaches: BioID or APEX2-based techniques to systematically identify proteins in close proximity to CPR5 in different cellular contexts.

  • Genome editing: CRISPR/Cas9-mediated precise mutations to assess the functional importance of specific amino acid residues or domains.

  • Synthetic biology approaches: Engineering minimal systems to reconstitute CPR5 function in heterologous contexts to identify essential components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.