Recombinant Arabidopsis thaliana Protein disulfide-isomerase LQY1 (LQY1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them in your order. We will endeavor to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
LQY1; At1g75690; F10A5.12; F10A5.4; Protein disulfide-isomerase LQY1, chloroplastic; Protein LOW QUANTUM YIELD OF PHOTOSYSTEM II 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
44-154
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LQY1
Target Protein Sequence
AELDPNTVVAISVGVASVALGIGIPVFYETQIDNAAKRENTQPCFPCNGTGAQKCRLCVG SGNVTVELGGGEKEVSNCINCDGAGSLTCTTCQGSGVQPRYLDRREFKDDD
Uniprot No.

Target Background

Function
Protein disulfide-isomerase LQY1 likely plays a role in maintaining photosystem II (PSII) activity under high light conditions by forming a complex with HHL1. This complex regulates the repair and reassembly of PSII complexes.
Gene References Into Functions
  1. Research suggests that HHL1 forms a complex with LQY1, contributing to photodamage repair of PSII under high light conditions. PMID: 24632535
  2. LQY1 protein may be involved in maintaining PSII activity under high light by regulating repair and reassembly of PSII complexes. PMID: 21586683
  3. LQY1 plays a crucial role in maintaining the activity of photosystem II. Mutants lacking LQY1 are more susceptible to photoinhibition. PMID: 22080791
Database Links

KEGG: ath:AT1G75690

STRING: 3702.AT1G75690.1

UniGene: At.34746

Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein. Note=More abundant in stroma-exposed thylakoids.

Q&A

What is the molecular structure of LQY1 and how does it relate to its function?

LQY1 (Low Quantum Yield of PSII 1) is a thylakoid zinc-finger protein characterized by four CXXCXGXG repeats and an N-terminal transmembrane domain that anchors the protein to the thylakoid membrane from the stromal side . The full-length protein contains a chloroplast transit peptide, a transmembrane domain, and a C-terminal C4-type zinc-finger domain with the conserved CXXCXGXG motifs .

Inductively coupled plasma-mass spectrometry analysis has demonstrated that each LQY1 peptide coordinates two zinc ions through the cysteine residues in the four CXXCXGXG repeats . This structural arrangement is critical for its function as the zinc-finger domain exhibits protein disulfide isomerase (PDIase) activity, enabling it to modify thiol/disulfide bonds in target proteins . This activity allows LQY1 to participate in folding, disassembly, and/or assembly of cysteine-containing PSII subunits in land plants, particularly during repair processes following photodamage .

Why is LQY1 present in land plants but absent in algae and cyanobacteria?

LQY1 homologs are exclusively found in land plants (such as AtLQY1 in Arabidopsis thaliana) but are notably absent from the sequenced genomes of aquatic algae and cyanobacteria . This taxonomic distribution pattern suggests that LQY1 evolved as part of plant adaptations to terrestrial environments .

The evolutionary rationale appears to be related to mobility and environmental challenges. Land plants experience more extensive high light stress compared to aquatic photosynthetic organisms because they cannot change their position to avoid damaging light exposure . While aquatic algae and cyanobacteria can alter their depth in water bodies to escape excessive light, land plants have evolved additional protective mechanisms, including specialized thiol/disulfide-modulating proteins like LQY1 and CYO1/SCO2 (Shiyou1/Snowy Cotyledon2) . These proteins enhance the repair and reassembly cycle of PSII, helping land plants cope with the more variable and potentially damaging light conditions encountered in terrestrial habitats .

How does LQY1 contribute to PSII repair and protection mechanisms?

LQY1 plays critical roles in maintaining PSII efficiency through several mechanisms:

  • PSII repair cycle participation: LQY1 is associated with the PSII core monomer and the CP43-less PSII monomer, which is a recognized marker for ongoing PSII repair and reassembly . This association indicates direct involvement in the repair process.

  • Protein disulfide modulation: Recombinant LQY1 can catalyze both oxidative renaturation of reduced and denatured protein substrates and reductive renaturation of oxidized protein substrates . This bidirectional thiol/disulfide-modulating activity is crucial for proper folding and assembly of cysteine-containing PSII subunits.

  • Localization at repair sites: LQY1 is most abundant in stroma-exposed thylakoid membranes, where key steps of PSII repair occur . Under high light conditions, the amount of LQY1 associated with PSII monomers increases at the expense of free LQY1, indicating dynamic redistribution to sites requiring repair activity .

  • Enhancement of PSII core protein stability: When AtLQY1 was introduced into the cyanobacterium Synechocystis sp. PCC6803, the abundance of PSII core proteins D1 and D2 increased by 16% and up to 33%, respectively . This suggests that LQY1 stabilizes these critical PSII components.

What protocols are most effective for analyzing LQY1's PDIase activity in vitro?

Researchers investigating LQY1's protein disulfide isomerase activity should consider the following methodological approach:

  • Recombinant protein expression and purification: Express the zinc-finger domain of AtLQY1 in a suitable expression system, ensuring proper folding and zinc incorporation. Purification methods should preserve the native conformation of the zinc-finger motifs.

  • Activity assays: Two primary assays should be conducted to comprehensively assess PDIase activity:

    • Oxidative renaturation assay: Using reduced and denatured protein substrates (such as RNase A) to measure LQY1's ability to catalyze disulfide bond formation

    • Reductive renaturation assay: Using oxidized protein substrates to evaluate LQY1's capacity to reduce incorrect disulfide bonds

  • Control experiments: Include proper controls such as:

    • Heat-inactivated LQY1 to confirm enzymatic nature of the activity

    • Known PDIases with established activity levels for comparison

    • Substrate-only controls to account for spontaneous oxidation/reduction

  • Quantification methods: Enzymatic activity should be quantified through:

    • Spectrophotometric measurement of substrate reactivation

    • Gel-shift assays to visualize changes in substrate mobility due to redox state alterations

    • Time-course experiments to determine reaction kinetics

The ability of recombinant LQY1 to catalyze both oxidative and reductive renaturation distinguishes it from many other thiol/disulfide-modulating proteins and confirms its role in bidirectional redox modulation of protein substrates .

How can researchers effectively generate and validate LQY1 mutants?

The generation and validation of LQY1 mutants require careful experimental design:

  • Mutant generation approaches:

    • T-DNA insertion mutants: T-DNA insertions in the Arabidopsis LQY1 gene have been successfully used to create knockout mutants .

    • CRISPR/Cas9 genome editing: For targeted modifications in the zinc-finger domain or other functional regions.

    • Point mutations: To specifically disrupt individual cysteine residues in the CXXCXGXG motifs for structure-function studies.

  • Phenotypic validation:

    • PSII efficiency measurements: LQY1 mutants typically show reduced efficiency of PSII photochemistry, particularly under high light conditions .

    • High light sensitivity: Mutants display increased sensitivity to high light stress .

    • ROS accumulation: Increased accumulation of reactive oxygen species under high light should be observed and quantified .

    • PSII-LHCII supercomplex analysis: Blue native gel electrophoresis to verify reduced accumulation of PSII-LHCII supercomplexes .

    • D1 turnover rates: Analysis of altered rates of high-light-induced D1 turnover and re-synthesis .

  • Complementation studies:

    • Introduction of wild-type LQY1 gene into the mutant background should restore normal phenotype, confirming the specificity of the observed effects .

    • Domain-specific complementation with modified versions of LQY1 can identify critical functional regions.

  • Controls and standards:

    • Wild-type plants grown under identical conditions

    • Heterozygous plants to assess gene dosage effects

    • Other PSII repair cycle mutants for comparative phenotypic analysis

What analytical approaches best capture LQY1's interactions with PSII complexes?

To effectively study LQY1's interactions with PSII subcomplexes, researchers should employ the following analytical techniques:

  • Protein complex separation and identification:

    • Blue Native-PAGE (BN-PAGE) to separate intact PSII subcomplexes (supercomplexes, dimers, monomers, and CP43-less monomers)

    • Two-dimensional electrophoresis (BN-PAGE followed by SDS-PAGE) to identify individual proteins within complexes

    • Western blot analysis using anti-LQY1 antibodies to detect LQY1 association with specific complexes

  • Co-immunoprecipitation approaches:

    • Anti-LQY1 antibodies to pull down LQY1 and associated proteins

    • Antibodies against PSII subunits (D1, D2, CP43, CP47) to assess LQY1 co-precipitation

    • Mass spectrometry analysis of co-immunoprecipitated proteins to identify the complete interactome

  • In vivo interaction studies:

    • Split-ubiquitin yeast two-hybrid assays to detect membrane protein interactions

    • Bimolecular fluorescence complementation to visualize protein interactions in plant cells

    • Fluorescence resonance energy transfer (FRET) to quantify protein proximity in thylakoid membranes

  • Dynamic interaction analysis:

    • Time-course experiments under high light stress to monitor changes in LQY1 association with PSII subcomplexes

    • Quantitative comparison of LQY1 distribution between free pools and PSII-associated pools under different light conditions

Research has shown that under high light, LQY1 associated with PSII monomers increases at the expense of free LQY1, suggesting dynamic redistribution during stress conditions . This indicates the importance of examining these interactions under physiologically relevant conditions rather than only at steady state.

How does high light stress modify LQY1's function and localization?

High light stress significantly alters LQY1's function and localization in plant cells:

  • Changes in protein distribution:

    • Under high light, the amount of LQY1 associated with PSII monomers increases, while the pool of free LQY1 decreases .

    • This redistribution indicates recruitment of LQY1 to sites of active PSII repair in response to stress.

  • Functional importance during stress:

    • T-DNA insertions in the Arabidopsis LQY1 gene result in heightened sensitivity to high light .

    • Mutant plants show increased accumulation of reactive oxygen species under high light conditions .

    • The altered rates of high-light-induced D1 turnover and re-synthesis in lqy1 mutants confirm LQY1's critical role in the PSII repair cycle during stress .

  • Temporal dynamics:

    • LQY1's involvement in PSII repair appears to be proportional to the intensity and duration of light stress.

    • Association with CP43-less PSII monomer (a marker for ongoing PSII repair) suggests that LQY1 acts during the disassembly and reassembly phases of repair .

  • Comparative response in wild-type versus mutant plants:

    • Wild-type plants show enhanced recruitment of LQY1 to PSII repair complexes under high light.

    • In lqy1 mutants, the lack of this response mechanism results in compromised PSII repair, reduced PSII-LHCII supercomplexes, and ultimately decreased photosynthetic efficiency .

The stress-responsive nature of LQY1 supports its evolved role in helping land plants cope with variable light conditions encountered in terrestrial environments, where mobility is not an option for avoiding light stress .

What is the relationship between LQY1 activity and ROS management in photosynthetic systems?

LQY1 plays a significant role in reactive oxygen species (ROS) management in photosynthetic systems, as evidenced by the following observations:

  • Direct effect on ROS levels:

    • T-DNA insertions in the Arabidopsis LQY1 gene lead to increased accumulation of ROS under high light conditions .

    • When AtLQY1 was introduced into Synechocystis sp. PCC6803, ROS levels were significantly reduced compared to the empty-vector control .

  • Relationship with nonphotochemical quenching (NPQ):

    • Loss-of-function Atlqy1 mutants display simultaneous increases in NPQ and ROS under high light conditions .

    • Conversely, AtLQY1-expressing Synechocystis showed lower NPQ and reduced ROS levels .

    This data is visualized in the following representation based on research findings:

    GenotypeNPQROS LevelsPSII Efficiency
    Wild-type ArabidopsisBaselineBaselineBaseline
    Atlqy1 mutantIncreasedIncreasedDecreased
    Synechocystis (control)BaselineBaselineBaseline
    Synechocystis+AtLQY1DecreasedDecreasedIncreased
  • Mechanism of ROS reduction:

    • LQY1 enhances the PSII repair cycle efficiency, reducing the lifetime of damaged PSII complexes that produce ROS .

    • By stabilizing PSII core proteins like D1 and D2, LQY1 helps maintain proper electron flow, preventing electron leakage that leads to ROS formation .

    • Through its PDIase activity, LQY1 ensures correct folding of thiol-containing PSII proteins, which may prevent improper electron transport that generates ROS .

  • Integration with plant photoprotection strategies:

    • While NPQ typically reduces photodamage at the cost of reduced photosynthetic efficiency, the LQY1-mediated approach maintains PSII integrity while potentially improving photosynthetic efficiency .

    • This suggests that enhancing repair mechanisms through LQY1 may be complementary to traditional NPQ-based photoprotection strategies.

What are the effects of heterologous expression of AtLQY1 in cyanobacteria?

The introduction of Arabidopsis thaliana LQY1 (AtLQY1) into the cyanobacterium Synechocystis sp. PCC6803 reveals interesting cross-kingdom effects and potential biotechnological applications:

  • Photosynthetic efficiency improvements:

    • AtLQY1-expressing Synechocystis demonstrated significantly higher Fv/F* (quantum yield of PSII) compared to the empty-vector control .

    • This indicates enhanced PSII efficiency despite Synechocystis naturally lacking LQY1 homologs.

  • Photoprotection enhancements:

    • Lower nonphotochemical quenching (NPQ) levels were observed in AtLQY1-expressing Synechocystis .

    • Reduced reactive oxygen species (ROS) accumulation was measured, particularly notable at moderate growth light intensity (50 μmol photons m-2 s-1) .

  • PSII protein stabilization:

    • The abundance of PSII core protein D1 in AtLQY1-expressing Synechocystis was approximately 16% higher than in the empty-vector control under both tested growth light conditions .

    • D2 protein levels showed even greater increases: 33% higher at 25 μmol photons m-2 s-1 and 18% higher at 50 μmol photons m-2 s-1 .

    This data can be represented as:

    ProteinIncrease at 25 μmol photons m-2 s-1Increase at 50 μmol photons m-2 s-1
    D1~16%~16%
    D233%18%
    PsaANo significant changeNo significant change
  • Specificity of effects:

    • The abundance of PSI core protein PsaA was statistically similar between AtLQY1-expressing Synechocystis and the empty-vector control .

    • This suggests that AtLQY1's effects are specific to PSII rather than affecting all photosynthetic complexes.

  • Mechanistic implications:

    • The ability of a land plant protein to function in cyanobacteria suggests that the target cysteine-containing PSII subunits and the mechanisms of PSII repair and reassembly are highly conserved across photosynthetic organisms .

    • The fact that introducing AtLQY1 provides benefits despite Synechocystis already possessing endogenous thiol/disulfide-modulating proteins suggests either complementary activity or targeting of different substrates .

These findings indicate that heterologous expression of plant-specific thiol/disulfide-modulating proteins could be a viable strategy for enhancing photosynthetic efficiency and stress tolerance in diverse photosynthetic organisms .

How does LQY1 coordinate with other thiol/disulfide-modulating proteins in photosynthetic organisms?

LQY1 functions within a complex network of thiol/disulfide-modulating proteins in the chloroplast, with distinct but potentially overlapping roles:

  • Complementary functions with other thiol/disulfide-modulating proteins:

    • Synechocystis already possesses endogenous chloroplastic thiol/disulfide-modulating proteins (such as TrxA encoded by slr0623, LTO1 encoded by slr0565, and CcdA encoded by slr0875) .

    • Despite this, introducing AtLQY1 still provides benefits, suggesting complementary rather than redundant functions .

  • Spatial organization of thiol/disulfide-modulating activities:

    • Different thiol/disulfide-modulating proteins likely target different substrates based on their subcellular localization :

      • LTO1: Likely targets lumenal and lumen-exposed thiol/disulfide-containing proteins due to its location

      • Trx-M: Primarily targets soluble thiol/disulfide-containing proteins in the chloroplast stroma

      • LQY1: With its N-terminal transmembrane domain anchored in thylakoid membranes and C-terminal zinc-finger domain in the stroma, LQY1 can potentially target both membrane and stromal proteins

  • Functional specialization:

    • LQY1 appears particularly important for PSII repair and reassembly, especially under high light stress .

    • Other thiol/disulfide-modulating proteins may have broader roles in protein folding, enzyme activation, or redox signaling throughout the chloroplast.

  • Evolutionary context:

    • Unlike LQY1, proteins like TrxA, LTO1, and CcdA are present ubiquitously in cyanobacteria, algae, and land plants .

    • This suggests that LQY1 evolved as a specialized addition to the existing thiol/disulfide-modulating network specifically to help land plants cope with terrestrial light environments .

  • Integrated stress response network:

    • The coordinated action of multiple thiol/disulfide-modulating proteins likely provides redundancy and fine-tuning of the redox control system.

    • Different proteins may be activated under specific stress conditions or developmental stages, ensuring appropriate responses to diverse environmental challenges.

Understanding these coordination mechanisms is crucial for developing strategies to enhance photosynthetic efficiency and stress tolerance in crops through genetic engineering approaches targeting the thiol/disulfide-modulating network.

What methodological approaches are most effective for studying LQY1's role in improving crop photosynthetic efficiency?

To thoroughly investigate LQY1's potential for enhancing crop photosynthetic efficiency, researchers should consider a multi-faceted methodological approach:

  • Genetic engineering strategies:

    • Overexpression studies: Creating transgenic crop plants with enhanced LQY1 expression to assess effects on photosynthetic efficiency

    • Precision modification: Using CRISPR/Cas9 to optimize native LQY1 genes in crops

    • Heterologous expression: Introducing LQY1 variants from stress-tolerant plant species into crop plants

    • Promoter swapping: Placing LQY1 under control of stress-responsive or tissue-specific promoters

  • Physiological assessment protocols:

    • Chlorophyll fluorescence analysis to measure PSII efficiency under varied light conditions

    • Gas exchange measurements to quantify photosynthetic rates and compare with wild-type plants

    • Light response curves to assess performance across different light intensities

    • Recovery kinetics after high light exposure to evaluate PSII repair efficiency

    • ROS accumulation measurements using fluorescent probes or histochemical staining

  • Molecular and biochemical analyses:

    • Quantification of PSII subcomplex composition using BN-PAGE and immunoblotting

    • Determination of D1 turnover rates using pulse-chase experiments

    • Assessment of thylakoid protein redox states using redox proteomics approaches

    • Analysis of LQY1 association with PSII repair complexes under different conditions

  • Field testing methodologies:

    • Multi-location trials to assess performance under varying environmental conditions

    • Controlled drought or temperature stress experiments to evaluate combined stress responses

    • Long-term growth analysis to determine if enhanced efficiency translates to improved yield

    • Comparative analysis between C3 and C4 crop species to identify potential differences in LQY1 contribution

  • Integration with other photosynthesis enhancement strategies:

    • Combining LQY1 optimization with NPQ modulation approaches

    • Pairing with Rubisco engineering or carbon concentrating mechanisms

    • Integration with strategies targeting other aspects of the light reactions

Recent research showing that down-regulation of NPQ can be a suitable strategy to improve photosynthetic efficiency in land plants and green algae suggests that LQY1's dual role in reducing NPQ while enhancing PSII repair efficiency may represent a particularly promising approach for crop improvement.

What are common challenges when studying LQY1 function and how can they be addressed?

Researchers investigating LQY1 function often encounter several challenges that require specific troubleshooting approaches:

  • Protein stability and purification issues:

    • Challenge: Recombinant LQY1 may show reduced stability or loss of zinc ions during purification.

    • Solution: Include zinc in purification buffers, use mild detergents for membrane protein extraction, optimize pH conditions to maintain zinc-finger integrity, and consider fusion tags that enhance stability without interfering with function.

  • Variability in mutant phenotypes:

    • Challenge: lqy1 mutant phenotypes may vary depending on growth conditions and plant developmental stage.

    • Solution: Implement strictly controlled growth conditions, use multiple biological replicates, perform time-course experiments across developmental stages, and always include wild-type controls grown simultaneously.

  • Protein interaction detection limitations:

    • Challenge: Transient or weak interactions between LQY1 and PSII subcomplexes may be difficult to capture.

    • Solution: Use crosslinking approaches before complex isolation, optimize detergent conditions to preserve native interactions, employ multiple complementary interaction detection methods, and design experiments under conditions that promote repair complex formation.

  • Functional redundancy with other thiol/disulfide-modulating proteins:

    • Challenge: Overlapping functions with other thiol/disulfide-modulating proteins may mask LQY1-specific effects.

    • Solution: Generate double or triple mutants affecting multiple thiol/disulfide-modulating proteins, use conditional expression systems, and develop assays that can distinguish LQY1-specific substrates from those targeted by other thiol/disulfide-modulating proteins.

  • Distinguishing direct from indirect effects:

    • Challenge: Determining whether observed phenotypes result directly from LQY1 activity or from secondary effects.

    • Solution: Use catalytically inactive LQY1 mutants (e.g., cysteine-to-serine mutations in the CXXCXGXG motifs), perform time-resolved experiments to establish causality, and develop in vitro assays with purified components to confirm direct effects.

By anticipating these challenges and implementing appropriate control experiments and methodological refinements, researchers can more effectively investigate LQY1's complex roles in photosynthetic organisms.

What controls and standards are essential when investigating recombinant LQY1 activity?

When studying recombinant LQY1 activity, incorporating appropriate controls and standards is crucial for generating reliable and interpretable results:

  • Protein quality controls:

    • Zinc content verification: Use inductively coupled plasma-mass spectrometry to confirm the presence of two zinc ions per LQY1 peptide, as this is essential for PDIase activity .

    • Folding assessment: Circular dichroism spectroscopy to verify proper protein folding.

    • Size and purity validation: SDS-PAGE and mass spectrometry to confirm protein integrity and absence of degradation products.

  • Activity assay controls:

    • Enzyme concentration series: Test multiple concentrations of recombinant LQY1 to establish dose-dependent activity.

    • Heat-inactivated LQY1: Use as a negative control to distinguish enzymatic activity from non-specific effects.

    • Commercial PDIases: Include as positive controls and activity standards for comparison.

    • Buffer-only controls: To account for spontaneous oxidation/reduction of substrates.

  • Substrate controls:

    • Multiple substrate types: Test activity on different thiol/disulfide-containing proteins to assess substrate specificity.

    • Pre-reduced/pre-oxidized samples: Establish baseline states for reductive and oxidative renaturation assays.

    • Non-thiol-containing substrates: Include as negative controls to confirm specificity for thiol/disulfide modulation.

  • Validation standards:

    • Alternative activity assays: Confirm results using multiple independent assay methods.

    • Known inhibitors: Test PDIase inhibitors to confirm that observed activity is mechanistically consistent with PDIase function.

    • Site-directed mutants: Create LQY1 variants with mutations in critical cysteine residues to verify the importance of specific CXXCXGXG motifs.

  • Contextual controls:

    • Physiological conditions: Perform assays under conditions that mimic the chloroplast environment (pH, salt concentration, redox state).

    • Time-course measurements: Establish reaction kinetics to distinguish between initial rates and endpoint measurements.

    • Alternative expression systems: Compare LQY1 produced in different expression systems to identify potential host-specific modifications.

What are promising avenues for expanding our understanding of LQY1's role in plant adaptation?

Several promising research directions could significantly advance our understanding of LQY1's role in plant adaptation:

  • Evolutionary studies:

    • Comparative analysis of LQY1 sequences across diverse land plant lineages to identify conserved features and adaptive variations

    • Investigation of LQY1 in early-diverging land plants to understand its evolutionary origins

    • Reconstruction of ancestral LQY1 proteins to test hypotheses about functional evolution during land plant diversification

  • Comprehensive substrate identification:

    • Proteomic approaches to identify the complete set of LQY1 target proteins in thylakoid membranes

    • Analysis of substrate specificity determinants through structural biology approaches

    • Investigation of potential non-PSII substrates to uncover additional roles of LQY1

  • Integration with signaling networks:

    • Examination of how LQY1 activity is regulated by retrograde signaling pathways

    • Investigation of potential post-translational modifications that might modulate LQY1 function

    • Studies on how LQY1 may coordinate with other stress response pathways

  • Environmental adaptation mechanisms:

    • Analysis of LQY1 function across multiple abiotic stresses beyond high light

    • Study of LQY1 variants from plants adapted to extreme environments (e.g., high altitude, desert)

    • Investigation of how LQY1 activity changes seasonally or during developmental transitions

  • Structural biology approaches:

    • Determination of the three-dimensional structure of LQY1, particularly focusing on the zinc-finger domain

    • Structural analysis of LQY1 in complex with PSII proteins to understand the molecular basis of its repair function

    • Molecular dynamics simulations to understand the conformational changes during catalysis

These research directions would not only advance our fundamental understanding of photosynthetic regulation but could also inform biotechnological approaches to enhance crop productivity under challenging environmental conditions.

How might LQY1 research contribute to developing climate-resilient crop varieties?

LQY1 research has significant potential to contribute to the development of climate-resilient crops through several translational pathways:

  • Enhanced photosynthetic efficiency under fluctuating light:

    • Engineering crops with optimized LQY1 expression to improve PSII repair efficiency during rapid light transitions

    • Developing varieties with enhanced recovery from photoinhibition for environments with variable cloud cover

    • Creating crops that maintain higher photosynthetic rates under natural fluctuating light conditions in field settings

  • Improved heat and drought tolerance:

    • Investigating how LQY1 function impacts combined high light and temperature stress responses

    • Developing crops with enhanced thylakoid membrane protein stability under heat stress through LQY1-mediated mechanisms

    • Exploring the role of LQY1 in maintaining photosynthetic efficiency during water limitation

  • Reduced photorespiration losses:

    • Examining how improved PSII repair through LQY1 optimization might reduce reactive oxygen species that contribute to photorespiratory losses

    • Investigating potential synergies between LQY1 enhancement and photorespiratory bypass engineering

  • Stacked trait approaches:

    • Combining LQY1 optimization with other photosynthetic enhancement strategies

    • Creating multi-trait improvement packages that address several aspects of photosynthetic efficiency

    • Developing breeding markers based on LQY1 sequence variations associated with stress tolerance

  • Adaptive response enhancement:

    • Engineering crops with environmentally responsive LQY1 expression to provide protection specifically when needed

    • Developing varieties with enhanced capacity to acclimate to changing light conditions

    • Creating crops with improved recovery mechanisms after extreme weather events

The finding that introducing AtLQY1 into Synechocystis resulted in enhanced photosynthetic efficiency and reduced ROS levels provides proof-of-concept that LQY1 manipulation can improve photosynthetic performance across significant evolutionary distances. This suggests broad applicability of LQY1-based approaches across diverse crop species.

What interdisciplinary approaches might yield breakthroughs in understanding LQY1's full functional spectrum?

Advancing our understanding of LQY1's complete functional spectrum will likely require interdisciplinary approaches that combine techniques and perspectives from multiple scientific fields:

  • Integration of structural biology and protein biochemistry:

    • Cryo-electron microscopy studies of LQY1 in complex with PSII repair intermediates

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic protein interfaces

    • Single-molecule FRET to observe conformational changes during LQY1-mediated protein folding

  • Combining systems biology with traditional plant physiology:

    • Multi-omics approaches (transcriptomics, proteomics, metabolomics) to identify networks affected by LQY1

    • Flux analysis to quantify the impact of LQY1 on photosynthetic electron transport rates

    • Mathematical modeling of PSII repair dynamics with and without functional LQY1

  • Merging synthetic biology and protein engineering:

    • Directed evolution of LQY1 to create variants with enhanced catalytic efficiency

    • Design of chimeric proteins combining functional domains from different thiol/disulfide-modulating proteins

    • Creation of synthetic regulatory circuits to control LQY1 activity in response to specific environmental cues

  • Collaborative crop science and molecular biology approaches:

    • Field-to-lab-to-field cycles combining agronomic evaluation with molecular mechanism studies

    • High-throughput phenotyping platforms to identify subtle effects of LQY1 variants on photosynthetic parameters

    • Genome editing of diverse crop species to test LQY1 function across genetic backgrounds

  • Computational biology and evolutionary science integration:

    • Molecular dynamics simulations of LQY1-substrate interactions

    • Ancestral sequence reconstruction to test hypotheses about functional evolution

    • Machine learning approaches to identify patterns in LQY1 sequence-function relationships across plant lineages

By fostering collaboration between researchers with diverse expertise and methodological approaches, these interdisciplinary strategies could overcome current technical limitations and conceptual gaps in our understanding of LQY1 function. This comprehensive knowledge would, in turn, inform both fundamental plant biology and applied crop improvement efforts focused on enhancing photosynthetic efficiency under changing climatic conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.