Recombinant Arabidopsis thaliana Protein ECHIDNA (ECH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ECH; At1g09330; T31J12.5; Golgi apparatus membrane protein-like protein ECHIDNA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ECH
Target Protein Sequence
MDPNNQIQAPVENYANPRTCLFHVLFKGAALAFYILSALFFNSFVIIFVVTVLLAALDFW VVKNVSGRILVGLRWWNEINDLGESVWKFESLDQESLARMNKKDSWLFWWTLYLAAAAWF ILGVFSLIRFQADYLLVVGVCLSLNVANIIGFTKCKKDAKKQFQQFASQTIASRFQSTVQ SAFTLV
Uniprot No.

Target Background

Function
ECHIDNA (ECH) mediates trans-Golgi network trafficking and cell elongation. It is essential for maintaining the balance between secretory trafficking and vacuolar targeting of specific proteins. The ECH/YIP4 complex modulates trans-Golgi network (TGN)-mediated trafficking of proteins and cell wall components (e.g., pectin and hemicellulose) to the cell wall in dark-grown hypocotyls and secretory cells of the seed coat.
Gene References Into Functions
  1. ECH expression is crucial for various aspects of male reproduction, including functional pollen grain production, release, germination, and tube formation. PMID: 24424320
  2. ECH protein is necessary for TGN-mediated trafficking of the auxin influx carrier AUX1 to the plasma membrane. PMID: 24043780
Database Links

KEGG: ath:AT1G09330

STRING: 3702.AT1G09330.1

UniGene: At.43661

Protein Families
TVP23 family
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein.

Q&A

What is the ECHIDNA protein and what is its cellular localization?

ECHIDNA (ECH) is an evolutionarily conserved protein in Arabidopsis thaliana that localizes to the trans-Golgi network (TGN). The protein is predicted to have three to four transmembrane domains and lacks an N-terminal signal sequence . ECH strongly colocalizes with TGN markers SYP41, SYP61, and vacuolar H⁺-ATPase subunit a1 (VHA-a1), suggesting it resides on a common subdomain of the TGN . Furthermore, rapid colabeling of ECH-EYFP with endocytic tracers confirms its presence in the TGN, which functions as an early endosome in plants .

How conserved is the ECHIDNA protein across species?

ECH demonstrates remarkable evolutionary conservation across plant species and beyond. Sequence analysis reveals homologs in various eukaryotes . The cDNA of ECH homolog from hybrid aspen (PttECH) can completely restore the Arabidopsis ech mutant phenotype to wild-type when driven by the 35S promoter, highlighting functional conservation between annual and perennial plants .

More surprisingly, ECH shares 34% identity and 53% similarity with the Tlg2p-vesicle protein 23 (Tvp23p) from budding yeast Saccharomyces cerevisiae. Expression of Arabidopsis ECH can restore growth of tvp23Δ ypt6Δ double mutants at non-permissive temperatures (35°C), demonstrating that ECH can functionally replace yeast TVP23 . This cross-kingdom complementation suggests fundamental aspects of ECH function have been conserved during evolution.

What are the preferred methods for genotyping Arabidopsis echidna mutants?

Arabidopsis echidna mutants can be identified using PCR-based genotyping with genomic DNA extracted from seedling leaves. For confirming T-DNA insertion in the ECHIDNA gene (the echidna allele), researchers typically use a combination of primers:

  • LB1 (5′-AAAAATGAAGTTGTTTAAAGTAGGTA-3′)

  • SAIL_163_E09-RP (5′-AGAGAAGAGTTATCGGGCTCG-3′)

To confirm the wild-type allele in the ECHIDNA gene, the following primer combination is recommended:

  • SAIL_163_E09-LP (5′-AAACGGAAAGGGAAACACAAC-3′)

  • SAIL_163_E09-RP (5′-AGAGAAGAGTTATCGGGCTCG-3′)

The commonly used echidna T-DNA insertion mutant line is SAIL_163_E09, which has been well-characterized in multiple studies .

What methods can be used to visualize and analyze ECH localization in plant cells?

For visualizing ECH subcellular localization, fluorescent protein fusion constructs have been successfully employed. ECH-EYFP (Enhanced Yellow Fluorescent Protein) fusions allow real-time imaging of the protein in living cells . To analyze colocalization with other subcellular markers, researchers typically use:

  • Coexpression of ECH-EYFP with established TGN markers such as SYP41, SYP61, or VHA-a1 fused to different fluorescent proteins

  • Endocytic tracer dyes like FM4-64 to confirm TGN localization

  • Time-lapse imaging to study dynamic association with Golgi bodies

For quantitative analysis of TGN-Golgi association in ech mutants versus wild-type, researchers measure the percentage of Golgi bodies associated with TGN compartments under confocal microscopy, which reveals significantly reduced association in ech mutants .

How does ECHIDNA affect secretory and endocytic trafficking pathways?

ECHIDNA plays a selective role in cellular trafficking pathways in Arabidopsis:

Secretory Pathway Effects:

  • ECH is required for efficient secretory trafficking, as demonstrated by the accumulation of secretory GFP (secGFP) inside ech mutant cells

  • The ech mutant shows defects in the secretion of soluble apoplast proteins

  • Membrane proteins targeted to the plasma membrane, such as auxin carriers (AUX1, PIN3), show trafficking defects in ech mutants

Endocytic Pathway Effects:

  • Notably, endocytosis appears unaffected in ech mutants, as demonstrated by normal internalization of the endocytic tracer FM4-64

  • This selective effect on secretory trafficking but not endocytosis suggests ECH plays a specific role in maintaining the proper balance between secretory trafficking and vacuolar targeting for a subset of proteins

The functional separation between secretory and endocytic trafficking at the TGN is a significant finding, as it demonstrates that these pathways can be genetically separated despite intersecting at the same organelle .

What is the relationship between ECHIDNA and vacuolar trafficking?

ECH plays a crucial role in vacuolar trafficking pathways and vacuolar development:

Protein Sorting to Vacuoles:

  • The echidna mutant exhibits defects in protein sorting to the protein storage vacuole (PSV)

  • This indicates ECH involvement in the vacuolar trafficking pathway in addition to its role in secretory pathway

Vacuolar Morphology:

  • In echidna mutants, the vacuolar membrane marker mCherry-VAMP711 labels aberrant structures in addition to the tonoplast

  • These aberrant structures include multi-layered or multi-membrane structures, aggregations of membrane compartments, and unidentified structures, usually greater than 10 μm in size

  • Protein storage vacuoles (PSVs) in echidna seed cells show greater size variability compared to wild-type seeds where PSVs are more uniformly sized

This suggests ECH is involved in proper vacuolar development for both lytic vacuoles in vegetative tissues and protein storage vacuoles in seeds .

How does ECHIDNA function in regulating seed coloration and flavonoid accumulation?

ECH plays a significant role in seed coloration through regulation of flavonoid accumulation:

Seed Coloration Phenotype:

  • Wild-type Arabidopsis seeds display a dark brown color throughout the seed body

  • In contrast, echidna mutant seeds exhibit a pale brown color with partially whitish seed bodies

  • When stained with p-dimethylaminocinnamaldehyde (a reagent that reacts with proanthocyanidins and their precursors), wild-type seeds are completely stained black, whereas echidna seeds are only partially stained

Mechanism of Action:

  • Flavonoids, including proanthocyanidins that determine seed coloration, are synthesized at the cytosolic surface of the endoplasmic reticulum and must be transported to and sequestered in the vacuole

  • ECH appears to regulate this process through its effects on membrane trafficking and vacuolar development

  • The defective pigmentation in echidna seeds is likely caused by reduced levels of proanthocyanidins

This indicates that proper vacuolar trafficking and/or vacuolar development, regulated by ECH, are required for flavonoid accumulation and subsequent seed coat pigmentation .

What is the genetic interaction between ECHIDNA and GREEN FLUORESCENT SEED 9?

Research has identified a significant genetic interaction between echidna and green fluorescent seed 9 (gfs9):

Phenotypic Effects of Double Mutants:

  • The echidna gfs9 double mutant shows enhanced growth defects compared to either single mutant

  • The double mutant is frequently unsuccessful in bolting inflorescence and flowering, resulting in defective seed production

Functional Relationship:

  • ECH localizes to the trans-Golgi network (TGN)

  • GFS9 is a Golgi-localized membrane trafficking factor also involved in flavonoid accumulation

  • The enhanced phenotype in the double mutant suggests that TGN-localized ECHIDNA and Golgi-localized GFS9 orchestrate intracellular trafficking of proteins and flavonoids through complementary but partially overlapping pathways

This genetic interaction provides important insights into how different components of the endomembrane system coordinate to regulate plant development and secondary metabolite accumulation .

How can recombinant ECH protein be expressed and purified for biochemical studies?

For recombinant expression and purification of ECH protein:

Expression Systems:

  • E. coli expression systems with N-terminal His₆-tags have been successfully used for expressing plant proteins

  • Both full-length ECH protein and mature protein (without the putative transit peptide) can be expressed

Purification Methods:

  • Affinity chromatography using Ni-NTA columns is effective for purifying His-tagged ECH protein

  • Size exclusion chromatography can be employed as a secondary purification step to achieve higher purity

Functional Validation:

  • Enzyme activity assays using different sulfur donors and acceptors can confirm proper folding and functionality

  • Cross-complementation assays in yeast tvp23Δ mutants provide an additional method to confirm functional activity of recombinant ECH

When designing expression constructs, it's important to consider that the ECH protein is predicted to have multiple transmembrane domains, which may affect solubility and require optimization of expression conditions or the use of detergents during purification.

What are the methods to study TGN integrity and function in echidna mutants?

Several approaches can be employed to study TGN integrity and function:

TGN Structure Analysis:

  • Electron microscopy to examine ultrastructural changes in the TGN

  • Quantification of Golgi-TGN association by measuring the percentage of Golgi bodies associated with TGN compartments under confocal microscopy

Protein Localization Studies:

  • Analysis of localization patterns of TGN-resident proteins (VHA-a1, SYP41, SYP61) using fluorescent protein fusions

  • Immunolocalization with specific antibodies against TGN proteins

Trafficking Assays:

  • Secretion assays using secGFP to measure secretory capacity

  • FM4-64 uptake assays to assess endocytic trafficking

  • BFA (Brefeldin A) treatment combined with protein localization studies to analyze protein trafficking routes

Pharmacological Approaches:

  • Treatment with concanamycin A (ConcA), a specific inhibitor of vacuolar H⁺-ATPases, which can phenocopy some aspects of the ech mutant, indicating the importance of VHA-a1 mislocalization in the ech phenotype

These methods provide complementary data on how ECH contributes to TGN structure and function in plant cells.

How should researchers interpret contradictions in phenotypic data between different echidna mutant studies?

When confronting contradictory phenotypic data in echidna mutant studies, researchers should consider:

Genetic Background Effects:

  • Different ecotypes (Columbia-0, Columbia-3) may show varying phenotype severity

  • The presence of modifying alleles in different backgrounds may affect phenotype expression

Environmental Conditions:

  • Growth conditions (light intensity, temperature, humidity) should be standardized and reported

  • Stress conditions may enhance or mask certain phenotypes

Allelic Differences:

  • Different T-DNA insertion lines (e.g., SAIL_163_E09) may have varying levels of residual ECH function

  • Confirm complete loss of expression through RT-PCR or Western blot analysis

Developmental Timing:

  • Phenotypic analyses should be conducted at equivalent developmental stages

  • Some phenotypes may be age-dependent or tissue-specific

Methodological Approaches:

  • Different detection methods may vary in sensitivity

  • For flavonoid analyses, different staining methods (p-dimethylaminocinnamaldehyde vs. others) may detect different subsets of compounds

Creating a comprehensive table comparing experimental conditions, genetic backgrounds, and methodologies across studies can help identify sources of variation and resolve apparent contradictions.

What statistical approaches are most appropriate for quantifying vacuolar morphology defects in echidna mutants?

For robust quantification of vacuolar morphology defects:

Measurement Parameters:

  • PSV diameter: Measure the diameter of multiple PSVs within cells, recording the largest PSV separately

  • Size distribution: Calculate standard deviation of PSV sizes to quantify uniformity

  • Vacuolar number: Count total vacuoles per cell in equivalent developmental stages

  • Aberrant structure frequency: Quantify the percentage of cells showing multi-layered membranes or aggregations

Statistical Methods:

  • For comparing PSV size: Two-tailed Student's t-test when comparing two genotypes

  • For comparing size distributions: F-test to compare variances between wild-type and mutant

  • For non-normally distributed data: Non-parametric tests like Mann-Whitney U test

  • For multiple genotype comparisons: One-way ANOVA followed by Tukey's HSD post-hoc test

Sample Size Considerations:

  • Analyze at least 50-100 cells per genotype

  • Include cells from multiple independent plants (biological replicates)

  • Analyze multiple developmental stages to track temporal changes

Data Visualization:

  • Box plots showing PSV size distribution with outliers

  • Violin plots to visualize distribution patterns

  • Representative microscopy images with scale bars

This approach allows for comprehensive quantification of vacuolar morphology defects in echidna mutants compared to wild-type plants.

What are promising approaches to identify ECH protein interaction partners?

Several complementary approaches can be employed to identify ECH protein interaction partners:

Yeast Two-Hybrid Screening:

  • Using the cytosolic domains of ECH as bait to screen Arabidopsis cDNA libraries

  • Confirmation of interactions through targeted Y2H assays with candidate proteins

Co-Immunoprecipitation (Co-IP):

  • Using ECH-specific antibodies or epitope-tagged ECH to pull down interacting proteins

  • Mass spectrometry analysis of co-precipitated proteins

  • Validation of interactions through reciprocal Co-IP experiments

Proximity-Dependent Biotin Identification (BioID):

  • Fusion of ECH with a biotin ligase (BirA*) that biotinylates nearby proteins

  • Isolation of biotinylated proteins and identification by mass spectrometry

  • This method is particularly suitable for identifying transient or weak interactions

Split-GFP Complementation Assays:

  • In vivo validation of specific protein interactions

  • Particularly useful for membrane proteins like ECH

Genetic Interactions:

  • Creation of double mutants between echidna and other trafficking mutants

  • Analysis of synthetic phenotypes that may indicate functional relationships

  • The established interaction with GFS9 provides a template for this approach

These methods would help build a comprehensive interactome map for ECH, advancing our understanding of its molecular function in the TGN.

How might CRISPR/Cas9 technology advance ECHIDNA functional studies?

CRISPR/Cas9 technology offers several advantages for advancing ECHIDNA functional studies:

Domain-Specific Mutations:

  • Creation of precise mutations in specific domains of ECH to analyze domain function

  • Engineering conservative amino acid substitutions in transmembrane regions to study topology

  • Targeted mutations in conserved residues identified through phylogenetic analysis

Tissue-Specific Knockouts:

  • Using tissue-specific promoters to drive Cas9 expression for tissue-specific ECH knockout

  • This would help distinguish between direct and indirect effects of ECH loss

  • Particularly useful for analyzing seed-specific versus vegetative phenotypes

Knock-In Tagging:

  • Precise insertion of fluorescent tags at the endogenous ECH locus

  • This maintains native expression levels and patterns, avoiding overexpression artifacts

  • Creation of various reporter fusions to study protein dynamics

Multiplexed Gene Editing:

  • Simultaneous targeting of ECH and interacting partners or related genes

  • Creation of higher-order mutants to uncover functional redundancy

  • Analysis of genetic interaction networks through systematic multiplexed editing

Inducible Systems:

  • Integration with inducible CRISPR systems for temporal control of gene editing

  • Allows study of ECH function at specific developmental stages

  • Useful for bypassing early developmental defects to study adult phenotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.