Recombinant Arabidopsis thaliana Protein MITOFERRINLIKE 1, chloroplastic (MFL1)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MFL1 (UniProt ID: Q9FHX2) is a chloroplast-localized transporter belonging to the mitochondrial carrier family (MCF). Recombinant MFL1 is produced in E. coli with an N-terminal His tag for purification and detection . Key characteristics include:

PropertyDetails
SpeciesArabidopsis thaliana (Mouse-ear cress)
SourceE. coli expression system
TagN-terminal 10xHis
Protein LengthFull-length mature protein (residues 93–412)
Molecular Weight~37 kDa (calculated)
Purity>90% (SDS-PAGE verified)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -80°C
ReconstitutionSterile water or glycerol-supplemented buffers (5–50%)

Role in Chloroplast Iron Transport

MFL1 is implicated in iron homeostasis within chloroplasts. Studies suggest it facilitates iron uptake, with mutants showing reduced vegetative growth under iron-limited conditions . STRING database analysis links MFL1 to iron-sulfur cluster assembly and reactive oxygen species (ROS) regulation .

S-Adenosyl Methionine (SAM) Transport

Experimental evidence from heterologous expression in Saccharomyces cerevisiae and phenotypic analysis of MFL1-deficient A. thaliana indicates a potential role in SAM transport into chloroplasts, critical for methylation and polyamine biosynthesis .

Stress Response

MFL1 interacts with proteins involved in salt stress tolerance, such as IP5P7 (inositol polyphosphate phosphatase), suggesting a role in ROS signaling and stress-responsive gene regulation .

Key Studies

  • Bioinformatic Predictions: MFL1 shares structural homology with mitochondrial iron transporters (mitoferrins), supporting its role in chloroplast iron transport .

  • Heterologous Expression: MFL1 expression in yeast rescued growth defects under iron-deficient conditions, confirming functional conservation .

  • Mutant Phenotypes: A. thaliana mfl1 mutants exhibit chlorosis and impaired photosynthesis under high-light stress, linking MFL1 to chloroplast redox balance .

Interaction Network

STRING-db analysis identifies functional partners involved in chloroplast metal logistics :

Interacting ProteinFunction
IREG3Plastid iron chelation and storage
TIC21Chloroplast iron permease
FRO7Ferric reductase for chloroplast iron uptake
NEETIron-sulfur cluster transfer and ROS regulation
IP5P7Phosphoinositide metabolism and salt stress response

Applications in Research

Recombinant MFL1 is used to:

  • Study chloroplast iron transport mechanisms.

  • Investigate SAM-dependent metabolic pathways.

  • Develop stress-tolerant crop variants via genetic engineering.

Technical Notes

  • Reconstitution: For optimal activity, dissolve lyophilized protein in sterile water to 0.1–1.0 mg/mL and avoid repeated freeze-thaw cycles .

  • Activity Assays: Functional studies require reconstitution into liposomes or chloroplast membrane models to assess transport kinetics .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: Our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MFL1; At5g42130; MJC20.24; Protein MITOFERRINLIKE 1, chloroplastic; AtMFL1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
93-412
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MFL1
Target Protein Sequence
PASRSSPRIQTLIKQLSVWERAIIGAGAGGLAGAFTYVTLLPLDAIKTKLQTKGASQVYS NTFDAIVKTFQAKGILGFYSGVSAVIVGSTFSSAVYFGTCEFGKSLLSKFPDFPTVLIPP TAGAMGNIISSAIMVPKELITQRMQAGASGRSYQVLLKILEKDGILGLYAGYSATLLRNL PAGVLSYSSFEYLKAAVLEKTKQSHLEPLQSVCCGALAGAISASITTPLDVVKTRLMTQI HVEAVDKLGGAMYTGVAGTVKQILTEEGWVGFTRGMGPRVVHSACFSAIGYFAFETARLT ILNEYLKRKEESEANVAADS
Uniprot No.

Target Background

Function
Likely plays a role in iron transport into chloroplasts.
Gene References Into Functions
  1. Expression of the At5g42130 gene is correlated with genes involved in chloroplast iron metabolism. PMID: 21371898
Database Links

KEGG: ath:AT5G42130

STRING: 3702.AT5G42130.1

UniGene: At.30188

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in leaves, developing flowers and siliques.

Q&A

What is MFL1 and where is it localized in Arabidopsis thaliana cells?

MFL1 (MitoFerrinLike1) is a transport protein encoded by the gene At5g42130 in Arabidopsis thaliana. Despite its name suggesting mitochondrial localization, multiple research groups have identified MFL1 and its homologs in the inner chloroplastic envelope membrane proteome, not in the mitochondrial proteome . This protein was initially identified through searches for proteins homologous to Danio rerio (zebrafish) Mitoferrin2 (MFRN2), which functions as a mitochondrial iron importer in non-erythroid cells . Notably, AtMfl1 expression strongly correlates with genes involved in chloroplast metabolism, supporting its chloroplastic rather than mitochondrial localization .

How does iron availability affect MFL1 expression in Arabidopsis?

MFL1 gene expression demonstrates a clear dependence on iron (Fe) supply. Experimental data shows that:

Fe ConditionMFL1 Transcript Level
Fe ExcessStrong accumulation
Fe SufficiencyModerate expression
Fe DeficiencyWeak expression

This regulatory pattern suggests that MFL1 expression adapts to cellular iron status, with maximum expression occurring under conditions of iron excess . This expression pattern aligns with its proposed role in chloroplastic iron transport, potentially serving as a mechanism to sequester excess iron into chloroplasts under high iron conditions.

What phenotypes are observed in MFL1 knockout mutants?

Two independent MFL1 knockout mutants, atmfl1-1 and atmfl1-2, display several distinct phenotypes:

  • Reduced vegetative growth compared to wild-type plants

  • Decreased total iron content in seedlings and rosette leaves when grown under iron excess conditions

  • Reduced expression of the iron storage ferritin AtFer1

These phenotypic characteristics suggest that MFL1 plays an important role in iron accumulation and plant development. The reduced growth might result from compromised chloroplast function due to suboptimal iron availability for essential processes like photosynthesis .

How does MFL1 contribute to chloroplast iron homeostasis in relation to other known iron transporters?

While Permease in Chloroplast 1 (PIC1) is considered a primary iron transporter in chloroplasts, MFL1 appears to be an auxiliary transporter that becomes particularly important under specific conditions, especially iron excess . Current research suggests MFL1 may function as part of a complex network regulating chloroplastic iron transport that includes:

  • PIC1 as the main iron importer

  • MFL1 as a conditional transporter responsive to high iron levels

  • Other transporters that remain to be fully characterized

Under iron excess conditions, MFL1 knockout mutants accumulate significantly less iron than wild-type plants, suggesting that MFL1 is particularly important for iron uptake into chloroplasts when external iron concentrations are high . This indicates a specialized role rather than redundancy with PIC1, possibly helping to prevent iron toxicity by sequestering excess iron into chloroplasts for storage in ferritin complexes.

What is the evidence suggesting MFL1 may transport S-adenosyl methionine rather than iron into chloroplasts?

Recent experimental approaches including bioinformatics prediction, Golden Gate cloning experiments, and heterologous expression in Saccharomyces cerevisiae have provided evidence that MFL1 may transport S-adenosyl methionine (SAM) into chloroplasts . This represents a significant shift from the initial hypothesis that MFL1 primarily transports iron.

The evidence supporting this role includes:

  • Bioinformatic analyses revealing structural similarities to known SAM transporters

  • Growth assays in yeast expressing MFL1 under different nutrient conditions

  • Phenotypic observations in Arabidopsis under varying CO₂ conditions that align with altered SAM transport

This potential dual function or alternative substrate specificity introduces new questions about MFL1's precise role in chloroplast metabolism, particularly regarding how it might influence methylation reactions within the chloroplast that depend on SAM availability.

How do MFL1 expression patterns correlate with photosynthetic activity and chloroplast development?

Transcriptome analyses reveal that MFL1 expression strongly correlates with genes encoding proteins involved in chloroplast metabolism . This pattern suggests coordination between MFL1 activity and photosynthetic functions. Specifically:

  • MFL1 expression increases during leaf development stages when chloroplasts mature

  • Expression patterns align with genes encoding components of photosynthetic electron transport chains

  • MFL1 transcript levels respond to light conditions that stimulate photosynthesis

The correlation between MFL1 expression and chloroplast function supports its role in transporting essential cofactors (either iron or SAM) required for photosynthetic processes, including the synthesis of iron-containing components like heme, plastoquinone, and iron-sulfur clusters that participate in electron transfer during photosynthesis .

What are the recommended protocols for generating and characterizing MFL1 knockout mutants?

Based on published research methodologies, the following protocol is recommended for generating and characterizing MFL1 knockout mutants:

  • Mutant Identification and Isolation:

    • Utilize T-DNA insertional mutants available from seed repositories (e.g., SALK lines)

    • Screen for homozygous lines using PCR with gene-specific and T-DNA border primers

    • Confirm knockout status by RT-PCR to verify absence of wild-type transcript

  • Phenotypic Characterization:

    • Compare vegetative growth parameters (rosette diameter, plant height, leaf number)

    • Analyze iron content using inductively coupled plasma mass spectrometry (ICP-MS)

    • Measure ferritin expression levels using quantitative RT-PCR

    • Assess photosynthetic parameters using chlorophyll fluorescence techniques

  • Complementation Studies:

    • Transform mutant lines with wild-type MFL1 under native promoter control

    • Verify restoration of phenotype to confirm specificity of observed effects

For comprehensive analysis, growth experiments should be conducted under varying iron conditions (deficiency, sufficiency, excess) using defined media with controlled iron availability .

What techniques are effective for recombinant expression and purification of MFL1 protein?

For successful recombinant expression and purification of MFL1 protein:

  • Expression System Selection:

    • Prokaryotic systems (E. coli): Use strains optimized for membrane protein expression (C41(DE3), C43(DE3))

    • Eukaryotic systems: Consider using Saccharomyces cerevisiae or insect cell systems for proper folding

  • Expression Construct Design:

    • Remove chloroplast transit peptide (first 40-60 amino acids) based on bioinformatic prediction

    • Add purification tags (His6 or Strep-tag) at C-terminus to avoid interference with targeting

    • Consider fusion with GFP for expression monitoring and solubility enhancement

  • Solubilization and Purification Protocol:

    • Isolate membrane fractions by differential centrifugation

    • Solubilize using mild detergents (DDM, LMNG, or digitonin at 1-2%)

    • Purify using affinity chromatography followed by size exclusion chromatography

    • Maintain reducing conditions throughout purification (5mM DTT or 2mM β-mercaptoethanol)

  • Functional Verification:

    • Reconstitute purified protein into liposomes

    • Perform transport assays using radiolabeled substrates (⁵⁵Fe or ³H-SAM)

    • Validate substrate specificity using competition assays

This approach accounts for the challenges of expressing membrane proteins while preserving functionality for downstream analyses .

How can researchers effectively study the iron transport activity of MFL1 in vitro?

To study the iron transport activity of MFL1 in vitro:

  • Liposome Reconstitution Assay:

    • Purify recombinant MFL1 as described above

    • Prepare liposomes using chloroplast lipid composition (MGDG, DGDG, SQDG, PG)

    • Incorporate purified MFL1 using detergent removal methods (dialysis or Bio-Beads)

    • Load liposomes with iron chelator (e.g., bathophenanthroline disulfonate)

    • Measure ⁵⁵Fe uptake into liposomes over time

  • Patch-Clamp Electrophysiology:

    • Express MFL1 in Xenopus oocytes or create giant liposomes

    • Measure ion currents in response to varying iron concentrations

    • Determine substrate specificity by comparing currents with different potential substrates

  • Isothermal Titration Calorimetry (ITC):

    • Purify MFL1 in appropriate detergent micelles

    • Measure binding affinity for Fe²⁺, Fe³⁺, and other potential substrates including SAM

    • Determine thermodynamic parameters of binding

  • Substrate Competition Assays:

    • Perform transport assays with radiolabeled iron in the presence of increasing concentrations of non-labeled potential competitors

    • Calculate IC₅₀ values to determine relative affinities

These methodologies enable quantitative assessment of transport activity, substrate specificity, and kinetic parameters that define MFL1 function .

How should researchers interpret conflicting data regarding MFL1 substrate specificity?

When faced with conflicting data regarding MFL1 substrate specificity (iron vs. S-adenosyl methionine):

  • Consider Technical Differences:

    • Evaluate experimental systems used (in vitro reconstitution vs. in vivo studies)

    • Assess protein expression levels and localization verification methods

    • Compare assay sensitivities and detection limits

  • Biological Context Analysis:

    • Examine cellular conditions under which experiments were performed

    • Consider iron status of experimental system (deficient, sufficient, excess)

    • Evaluate potential post-translational modifications affecting specificity

  • Dual Functionality Assessment:

    • Test the hypothesis that MFL1 may transport both substrates under different conditions

    • Examine structural models for substrate binding sites

    • Compare with other transporters known to have multiple substrates

  • Experimental Resolution Approach:

    ApproachMethodologyExpected Outcome
    Direct comparisonParallel transport assays with both substratesDetermination of primary substrate
    MutagenesisTargeted mutations in predicted binding sitesIdentification of residues critical for each substrate
    In vivo trackingIsotope labeling of substrates in plant systemsVerification of physiological substrate

When analyzing conflicting results, researchers should consider that transport proteins may have evolved to accommodate multiple substrates, or that experimental conditions might not fully replicate the native chloroplastic environment .

What statistical approaches are most appropriate for analyzing growth phenotypes in MFL1 mutants?

To rigorously analyze growth phenotypes in MFL1 mutants:

  • Experimental Design Considerations:

    • Use randomized complete block designs to control for environmental variation

    • Include multiple biological replicates (minimum n=15-20 plants per genotype)

    • Implement technical replicates for measurements

    • Include appropriate controls (wild-type, complementation lines)

  • Statistical Methods for Analysis:

    • For normally distributed data: ANOVA followed by post-hoc tests (Tukey's HSD)

    • For non-parametric data: Kruskal-Wallis followed by Dunn's test

    • For growth over time: Repeated measures ANOVA or mixed-effects models

    • For multiple correlated phenotypes: MANOVA or principal component analysis

  • Effect Size Calculation:

    • Report Cohen's d or percent difference to quantify magnitude of effects

    • Include confidence intervals for all measurements

    • Use standardized effect sizes when comparing across studies

  • Special Considerations for MFL1 Research:

    • Account for iron availability as a covariate in statistical models

    • Consider interaction terms between genotype and environmental conditions

    • Use regression analysis to correlate phenotypes with molecular measurements

By employing these statistical approaches, researchers can distinguish between biologically significant effects and statistical artifacts, particularly important when analyzing subtle phenotypes that may result from altered chloroplast transport functions .

How might MFL1 function interact with photosynthetic efficiency and photorespiration pathways?

MFL1's potential dual role in transporting iron and/or S-adenosyl methionine has significant implications for photosynthetic efficiency:

  • Iron Transport Function:

    • Iron is essential for photosynthetic electron transport chain components

    • Fe-S clusters in Photosystem I require continuous iron supply

    • Reduced iron availability in mfl1 mutants may limit electron transport capacity

    • This could explain the reduced growth phenotype under specific conditions

  • SAM Transport Function:

    • SAM is required for chlorophyll synthesis and methylation of photosynthetic proteins

    • Altered SAM availability affects thylakoid membrane composition

    • Studies suggest 25% of photosynthetic energy is wasted in photorespiration

    • MFL1 may contribute to photorespiratory efficiency through SAM-dependent pathways

  • Interaction with CO₂ Conditions:

    • MFL1 deficient plants show altered responses to high, ambient, and low CO₂ conditions

    • This suggests a connection to carbon fixation and photorespiratory pathways

    • The plastidic glycolate glycerate transporter (PLGG1) functions in photorespiration

    • MFL1 may work in concert with PLGG1 to balance photosynthesis and photorespiration

Research examining photosynthetic parameters under varying light intensities and CO₂ concentrations would further elucidate these interactions and potentially reveal how MFL1 contributes to photosynthetic efficiency optimization.

What evolutionary insights can be gained from comparing MFL1 with similar transporters across plant species?

Evolutionary analysis of MFL1 provides insights into chloroplast transporter specialization:

  • Phylogenetic Distribution:

    • MFL1 homologs are present across diverse plant species

    • The protein shows higher conservation in its transmembrane domains than in terminal regions

    • Comparison with animal mitoferrin proteins reveals divergent evolution after the plant-animal split

  • Functional Divergence:

    • While animal mitoferrins primarily function in mitochondria, plant MFL1 functions in chloroplasts

    • This represents an example of subcellular relocalization during evolution

    • The acquisition of chloroplast targeting signals likely occurred after endosymbiosis

  • Substrate Specificity Evolution:

    • The potential dual specificity for iron and SAM may represent evolutionary adaptation

    • Comparison with specialized transporters may reveal how substrate specificity evolved

    • Specific amino acid substitutions in transmembrane domains likely account for differences in substrate preferences

  • Selection Pressure Analysis:

    • Regions under positive selection may indicate adaptation to different photosynthetic environments

    • Conservation patterns can identify functionally critical residues

    • Differential expression patterns across species may reflect adaptation to varying iron availability in different ecological niches

This evolutionary perspective helps understand how plants have adapted their chloroplast transport mechanisms to optimize photosynthetic efficiency under diverse environmental conditions .

How can CRISPR-Cas9 gene editing be optimized for studying MFL1 function?

For optimal CRISPR-Cas9 editing of MFL1:

  • Guide RNA Design Strategy:

    • Target conserved exonic regions, particularly in transmembrane domains

    • Design multiple gRNAs targeting different regions (exons 1, 5, and 9)

    • Avoid regions with high GC content (>80%) or low GC content (<20%)

    • Use algorithms that predict off-target effects (e.g., CRISPOR, Cas-OFFinder)

  • Construct Development:

    ComponentRecommendationRationale
    Promoter for Cas9UBQ10 or EC1.2Provides appropriate expression levels
    Promoter for gRNAU6-26Strong expression in Arabidopsis
    Selection markerBASTA resistanceEffective for Arabidopsis screening
    Screening strategyRE-site loss/gainSimplifies mutant identification
  • Editing Strategies Beyond Knockouts:

    • Base editing: For studying specific amino acid changes

    • Prime editing: For precise substitutions without double-strand breaks

    • Knock-in approaches: For adding reporter tags to study localization

  • Phenotypic Evaluation Framework:

    • Compare with T-DNA insertion mutants to validate phenotypes

    • Generate allelic series to study partial loss of function

    • Create tissue-specific knockouts using tissue-specific promoters for Cas9

This comprehensive CRISPR approach enables more precise manipulation of MFL1 than traditional methods, allowing researchers to address specific questions about protein domains and their functions .

What high-throughput approaches can identify interaction partners of MFL1 in chloroplasts?

To identify MFL1 interaction partners:

  • Proximity-Based Approaches:

    • BioID fusion with MFL1 for in vivo proximity labeling

    • Split-TurboID system for detecting transient interactions

    • APEX2-based proximity labeling for temporal control of labeling

  • Co-Immunoprecipitation Combined with Mass Spectrometry:

    • Generate plants expressing epitope-tagged MFL1 (FLAG, HA, or GFP)

    • Isolate intact chloroplasts to reduce non-specific interactions

    • Employ crosslinking strategies (DSP, formaldehyde) to capture transient interactions

    • Use quantitative proteomics (SILAC or TMT) to differentiate true interactors from background

  • Membrane-Based Interaction Screens:

    • Split-ubiquitin membrane yeast two-hybrid

    • Membrane-based protein complementation assays

    • Bimolecular fluorescence complementation in chloroplasts

  • Computational Prediction and Validation:

    • Use co-expression analysis to identify functionally related proteins

    • Employ protein-protein interaction predictions based on structural models

    • Validate predictions with targeted co-IP or FRET experiments

These approaches should be applied under varying iron concentrations and developmental stages to capture condition-specific interactions that may reveal the regulatory networks controlling MFL1 function and substrate specificity .

What are the most promising avenues for translating MFL1 research into agricultural applications?

Translational research directions for MFL1 include:

  • Iron Biofortification Strategies:

    • Modulate MFL1 expression to enhance iron accumulation in edible tissues

    • Engineer MFL1 variants with increased transport efficiency

    • Combine with ferritin overexpression for enhanced iron storage

    • Target crops with nutritional iron deficiencies (rice, beans, wheat)

  • Stress Tolerance Enhancement:

    • Develop crops with optimized MFL1 expression for iron-limited soils

    • Engineer conditional expression systems responsive to iron availability

    • Create variants less sensitive to feedback inhibition

  • Photosynthetic Efficiency Improvement:

    • Optimize MFL1 expression to enhance photosynthetic capacity

    • Engineer plants with improved photorespiratory efficiency via MFL1-dependent pathways

    • Develop crops with enhanced carbon fixation under elevated CO₂ conditions

  • Genetic Resource Development:

    • Create MFL1 variant libraries for screening optimal alleles

    • Develop molecular markers for MFL1 alleles associated with desired traits

    • Identify natural variation in MFL1 across crop germplasm collections

The most promising approaches would integrate these strategies with comprehensive phenotypic analysis under field conditions to ensure that laboratory discoveries translate to agricultural benefits .

What challenges remain in understanding the complete functional profile of MFL1 in plant metabolism?

Several significant challenges remain in fully characterizing MFL1 function:

  • Substrate Specificity Resolution:

    • Definitively determining if MFL1 transports iron, SAM, or both

    • Characterizing transport kinetics under physiological conditions

    • Understanding regulatory mechanisms affecting substrate preference

  • Structural Characterization Barriers:

    • Obtaining high-resolution structures of membrane proteins remains technically challenging

    • Crystallizing transporters in different conformational states

    • Capturing substrate-bound structures to understand transport mechanism

  • Integration with Metabolic Networks:

    • Mapping how MFL1 function connects with broader chloroplast metabolism

    • Understanding temporal regulation during development and stress responses

    • Elucidating regulatory cross-talk between iron homeostasis and SAM metabolism

  • Technical Limitations:

    • Developing methods to monitor transport in real-time in living plants

    • Creating chloroplast-specific tools for studying organellar transport

    • Distinguishing direct from indirect effects in complex phenotypes

  • Knowledge Gaps:

    • Understanding post-translational modifications affecting MFL1 activity

    • Characterizing the impact of membrane lipid composition on transport function

    • Identifying regulatory proteins that modulate MFL1 activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.