Recombinant Arabidopsis thaliana Protein PAM68, chloroplastic (PAM68)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PAM68; At4g19100; T18B16.70; Protein PAM68, chloroplastic; PHOTOSYNTHESIS AFFECTED MUTANT 68
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-214
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PAM68
Target Protein Sequence
DKTKSQVPKSITCINRLEISRIAPLHATMNSPKGFGPPPKKTKKSKKPKPGNQSDEDDDD EDEDDDDEEDERERGVIPEIVTNRMISRMGFTVGLPLFIGLLFFPFFYYLKVGLKVDVPT WVPFIVSFVFFGTALAGVSYGIVSSSWDPLREGSLLGWNEAKKNWPVFWQSFWNSSDKR
Uniprot No.

Target Background

Function
PAM68 plays a crucial role in the early stages of photosystem II (PSII) biogenesis, contributing to the maturation and stability of newly synthesized psbA protein.
Gene References Into Functions
  1. PAM68 functions as a PSII assembly factor, influencing D1 maturation and stability. PMID: 20923938
Database Links

KEGG: ath:AT4G19100

STRING: 3702.AT4G19100.1

UniGene: At.6

Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is PAM68 and what is its primary function in Arabidopsis thaliana?

PAM68 (photosynthesis affected mutant 68) is a conserved integral membrane protein found in the thylakoid membranes of both cyanobacteria and eukaryotic photosynthetic organisms. In Arabidopsis thaliana, PAM68 functions as a critical assembly factor required for efficient accumulation of photosystem II (PSII) complexes. Specifically, it is involved in early steps of PSII assembly, promoting the biogenesis and stability of the D1 protein, a core component of the PSII reaction center. PAM68 appears to be essential for the efficient transition from the PSII reaction center-like assembly complex (RC) to larger PSII assembly complexes . The protein is encoded by the nuclear genome and targeted to the chloroplast via its N-terminal transit peptide, with the mature protein spanning amino acids 36-214 .

How is PAM68 structurally organized within the thylakoid membrane?

PAM68 is an intrinsic thylakoid membrane protein with two predicted transmembrane domains in the mature protein. Studies using tryptic digestion of isolated thylakoids have revealed that PAM68 adopts a specific conformation in the thylakoid membrane with both its N and C termini facing the stromal side . This topology is significant for its function, as it positions the protein's functional domains to interact with other PSII assembly factors and core proteins. When examining the primary sequence, PAM68 contains distinct stromal-exposed regions that likely mediate its protein-protein interactions with assembly factors such as LPA1 and structural components of PSII . The protein's membrane integration is confirmed by its resistance to extraction with alkaline and chaotropic salts, which typically remove peripheral membrane proteins .

What phenotypes are observed in pam68 mutants of Arabidopsis thaliana?

The pam68 mutants of Arabidopsis thaliana display several distinct phenotypes related to photosynthetic function. Most notably, these mutants exhibit drastically altered chlorophyll fluorescence patterns and abnormally low levels of the PSII core subunits D1, D2, CP43, and CP47 . The primary defect appears to be a specific decrease in the stability and maturation of the D1 protein. In pam68-2 mutants, researchers have observed an altered ratio between the precursor (pD1) and mature (mD1) forms of D1, with the precursor form being significantly overrepresented (pD1/mD1 ratio of ~0.85 compared to ~0.15 in wild type) . This indicates that processes triggering conversion of pD1 into mD1 are affected in the mutant. Another notable phenotype is a marked increase in the synthesis of the PSII reaction center-like assembly complex (RC) at the expense of PSII dimers and supercomplexes, suggesting a bottleneck in the assembly process .

How does PAM68 interact with other proteins involved in PSII assembly?

PAM68 functions within a network of protein interactions that facilitate PSII assembly. Split-ubiquitin assays have demonstrated that PAM68 interacts with several PSII core proteins and known PSII assembly factors . Biochemical analyses of thylakoids from both Arabidopsis and the cyanobacterium Synechocystis sp. PCC 6803 suggest that during PSII assembly, PAM68 proteins associate with an early intermediate complex that likely contains D1 and the assembly factor LPA1 . Specifically, PAM68 has been shown to interact with assembly factors including HCF136 and ALB3, as well as several structural subunits of PSII . Additionally, research indicates that the PAM68 homolog in Synechocystis, Sll0933, also participates in early PSII assembly but with some functional differences compared to the plant protein .

What experimental approaches are most effective for studying PAM68's role in D1 maturation?

To effectively investigate PAM68's role in D1 maturation, researchers should employ a multi-faceted approach combining genetic, biochemical, and imaging techniques. Pulse-chase experiments with radioactively labeled amino acids are particularly valuable for tracking D1 synthesis and turnover rates in wild-type versus pam68 mutant plants. This approach has revealed that PAM68 specifically affects D1 stability and maturation rather than its initial synthesis . Immunoblot analysis using antibodies against both precursor and mature forms of D1 can quantify the pD1/mD1 ratio, which is significantly altered in pam68 mutants (~0.85 compared to ~0.15 in wild type) . For precise quantification, researchers should extract total protein samples, normalize loading based on total protein content, and calculate signal intensities using appropriate software tools.

For studying the protein interactions involved in D1 maturation, split-ubiquitin assays have proven effective in identifying PAM68's interaction partners . Additionally, sucrose gradient ultracentrifugation of solubilized thylakoid complexes followed by immunoblot analysis of fractionated proteins allows researchers to detect and characterize the various PSII assembly intermediates affected by PAM68 deficiency . Blue native PAGE (BN-PAGE) coupled with second-dimension SDS-PAGE provides further resolution of these assembly intermediates and their subunit composition .

How can recombinant PAM68 protein be effectively used in reconstitution experiments?

Recombinant PAM68 protein can be utilized in reconstitution experiments to study its function in vitro and potentially restore PSII assembly in pam68 mutants. For optimal results, researchers should produce the full-length mature protein (amino acids 36-214) with an N-terminal His-tag using E. coli expression systems . The recombinant protein should be purified to greater than 90% homogeneity using metal affinity chromatography and verified by SDS-PAGE before use in experiments .

For membrane protein reconstitution, liposome-based approaches can be employed wherein purified recombinant PAM68 is incorporated into liposomes containing thylakoid lipids. These proteoliposomes can then be used in binding assays with purified PSII assembly intermediates to assess direct interactions. Alternatively, researchers can develop in vitro PSII assembly systems using isolated thylakoid membranes from pam68 mutants supplemented with recombinant PAM68 to determine if assembly defects can be rescued . When conducting these experiments, it is critical to maintain proper protein folding and orientation, as PAM68 adopts a specific conformation with both N and C termini facing the stroma .

What analytical techniques best characterize the PSII assembly intermediates affected by PAM68 deficiency?

Several complementary analytical techniques are essential for comprehensively characterizing the PSII assembly intermediates affected in pam68 mutants. Blue native polyacrylamide gel electrophoresis (BN-PAGE) serves as a primary technique for separating and visualizing intact thylakoid membrane protein complexes, including PSII assembly intermediates like the reaction center (RC), RC47, monomeric PSII, dimeric PSII, and supercomplexes . When combined with second-dimension SDS-PAGE and immunoblotting using antibodies against specific PSII subunits, this approach can reveal which assembly steps are impaired in pam68 mutants.

Sucrose gradient ultracentrifugation provides another effective separation method for solubilized thylakoid complexes, allowing for the isolation of distinct assembly intermediates based on their molecular weight and shape . For more detailed structural analysis, researchers should employ transmission electron microscopy (TEM) or single-particle cryo-electron microscopy (cryo-EM) to visualize the structural organization of assembly intermediates. Additionally, mass spectrometry-based approaches, particularly quantitative proteomics, can identify the precise protein composition of various assembly intermediates and detect even subtle changes in their stoichiometry resulting from PAM68 deficiency .

How do PAM68 functions differ between cyanobacteria and plants, and what methods best examine these differences?

The functional differences of PAM68 between cyanobacteria and plants can be systematically investigated using comparative genomics, biochemical analyses, and complementation studies. Research has shown that inactivation of PAM68 homolog Sll0933 in Synechocystis sp. PCC 6803 destabilizes the reaction center (RC) but does not affect larger PSII assembly complexes, whereas in Arabidopsis, PAM68 deficiency causes accumulation of RC at the expense of larger complexes . This suggests different compensatory mechanisms in the two organisms.

To examine these differences experimentally, researchers should conduct cross-species complementation studies by expressing cyanobacterial PAM68 in Arabidopsis pam68 mutants and vice versa. Thylakoid membrane preparations from these complemented lines can then be analyzed by BN-PAGE and immunoblotting to assess restoration of normal PSII assembly patterns . Protein-protein interaction studies using techniques like split-ubiquitin assays or co-immunoprecipitation with species-specific PAM68 variants can identify differences in interaction partners between cyanobacteria and plants . Time-resolved spectroscopic analyses of PSII assembly in both organisms, coupled with PAM68 mutant variants, could reveal kinetic differences in assembly pathways and identify species-specific rate-limiting steps influenced by PAM68 .

What strategies can be employed to investigate the molecular mechanism of PAM68-assisted D1 processing?

Investigating the molecular mechanism of PAM68-assisted D1 processing requires sophisticated approaches targeting the specific steps in D1 maturation. Since pam68 mutants show an increased ratio of precursor D1 (pD1) to mature D1 (mD1), research should focus on the C-terminal processing of D1 by the CtpA protease . In vitro processing assays using recombinant CtpA, D1 precursor protein, and PAM68 can determine whether PAM68 directly enhances CtpA activity or alters D1 conformation to facilitate processing. Site-directed mutagenesis of conserved PAM68 residues can identify domains critical for this function .

To investigate the dynamic interactions during D1 processing, researchers should employ real-time fluorescence resonance energy transfer (FRET) using fluorescently labeled PAM68, D1, and CtpA proteins. This approach can reveal the temporal sequence of protein interactions during D1 maturation. Additionally, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify conformational changes in D1 induced by PAM68 binding that might facilitate CtpA access . For in vivo studies, researchers can use inducible expression systems for PAM68 in pam68 mutant backgrounds, allowing time-course analysis of D1 processing restoration using pulse-chase labeling combined with immunoprecipitation .

What are the optimal conditions for expressing and purifying recombinant PAM68 protein?

For optimal expression and purification of recombinant PAM68 protein, researchers should consider both the protein's structural characteristics and downstream applications. The full-length mature PAM68 protein (amino acids 36-214) with an N-terminal His-tag can be successfully expressed in E. coli expression systems . When designing expression constructs, it's important to note that PAM68 is an integral membrane protein with two predicted transmembrane domains, which can complicate heterologous expression.

For improved solubility and proper folding, expression in E. coli strains engineered for membrane protein production (such as C41(DE3) or C43(DE3)) is recommended. Induction should be performed at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) to minimize inclusion body formation. For purification, a two-step approach is effective: initial metal affinity chromatography using Ni-NTA resin under mild detergent conditions (0.1-0.5% n-dodecyl-β-D-maltoside) followed by size exclusion chromatography to remove aggregates and obtain homogeneous protein . Throughout the purification process, maintaining a stable detergent environment is crucial to preserve the native structure of this membrane protein. The purified protein can be verified for purity (>90%) using SDS-PAGE and its identity confirmed by mass spectrometry or western blotting .

How can researchers accurately quantify PAM68 levels in thylakoid membranes?

Accurate quantification of PAM68 levels in thylakoid membranes requires careful consideration of sample preparation and analytical techniques. For absolute quantification, researchers should express and purify recombinant PAM68 protein to generate standard curves for calibration . Thylakoid membrane isolation should be performed using established protocols that maintain protein integrity, with samples normalized based on total chlorophyll content or total protein.

Immunoblotting with PAM68-specific antibodies provides the most direct method for quantification, but requires careful optimization of extraction conditions to fully solubilize this integral membrane protein. Researchers should use mild detergents like n-dodecyl-β-D-maltoside (β-DM) for extraction and include controls for extraction efficiency . For relative quantification across different samples or genotypes, multiple technical and biological replicates should be performed, with loading controls (such as the chloroplast ATPase β-subunit) to normalize signal intensities . For more precise absolute quantification, selected reaction monitoring (SRM) mass spectrometry using isotope-labeled reference peptides derived from PAM68 can determine exact copy numbers of the protein per thylakoid membrane area or chlorophyll basis .

What controls should be included when studying the effects of PAM68 mutation on photosystem II assembly?

When investigating the effects of PAM68 mutation on photosystem II assembly, researchers should implement a comprehensive set of controls to ensure reliable and interpretable results. The experimental design should include: (1) wild-type plants as positive controls; (2) pam68 mutant lines; (3) complemented lines expressing the PAM68 cDNA under control of its native promoter or a constitutive promoter like CaMV 35S; and (4) other PSII assembly mutants affecting different stages of assembly as comparative controls .

For biochemical studies of PSII assembly, researchers should examine multiple parameters including D1 synthesis and turnover, accumulation of PSII subunits, and formation of assembly intermediates. Control experiments must include assessment of other photosynthetic complexes (PSI, Cytochrome b6f, ATP synthase) to determine the specificity of assembly defects . When analyzing photosynthetic parameters, measurements should include both PSII quantum yield (ΦII) and chlorophyll fluorescence induction kinetics, with non-photochemical quenching (NPQ) measurements to control for potential secondary effects on thylakoid energization . For protein interaction studies, both positive controls (known interacting proteins) and negative controls (proteins not expected to interact with PAM68) should be included, and reciprocal experiments (e.g., pull-downs from both directions) should be performed to validate interactions .

How can researchers distinguish between direct and indirect effects of PAM68 on D1 maturation?

Distinguishing between direct and indirect effects of PAM68 on D1 maturation requires a combination of genetic, biochemical, and temporal approaches. To establish direct causality, researchers should conduct in vitro reconstitution experiments using purified components. This would involve isolating thylakoid membranes from pam68 mutants and adding recombinant PAM68 protein to determine if D1 maturation can be restored in a defined system . Time-resolved studies are particularly valuable—monitoring the kinetics of D1 processing immediately following inducible expression of PAM68 in a mutant background can reveal whether PAM68 acts directly or requires intermediate steps .

For identifying direct physical interactions, researchers should employ multiple complementary techniques: (1) in vitro binding assays with purified PAM68 and D1 protein; (2) co-immunoprecipitation experiments followed by mass spectrometry to identify interaction partners; and (3) chemical cross-linking studies to capture transient interactions during D1 maturation . Genetic approaches also provide valuable insights—researchers should create an allelic series of PAM68 mutants with varying degrees of function to correlate specific PAM68 domains with D1 maturation efficiency. Comparative analysis of double mutants combining pam68 with mutations in genes encoding other PSII assembly factors can reveal functional relationships and epistatic effects, helping to position PAM68 within the D1 maturation pathway .

What are the best approaches for studying evolutionary conservation and divergence of PAM68 function?

The evolutionary conservation and divergence of PAM68 function can be comprehensively investigated through a combination of phylogenetic, structural, and functional approaches. Phylogenetic analysis should begin with identification of PAM68 homologs across diverse photosynthetic organisms, from cyanobacteria to flowering plants, followed by construction of phylogenetic trees to visualize evolutionary relationships and gene duplication events . Multiple sequence alignments can identify conserved domains and residues that may be critical for the ancestral function of PAM68 proteins.

For functional studies, cross-species complementation experiments provide valuable insights—researchers should express PAM68 proteins from different evolutionary lineages (cyanobacteria, algae, moss, and flowering plants) in the Arabidopsis pam68 mutant background and assess rescue of photosynthetic phenotypes . Similar complementation studies in cyanobacterial PAM68 mutants (sll0933 in Synechocystis) can reveal functional conservation or divergence in the reverse direction . The special case of PAM68 and PAM68L in flowering plants deserves particular attention—examining the moss Physcomitrella patens, which contains only a single PAM68 gene, can illuminate the ancestral function before gene duplication . Researchers should determine whether the moss PAM68 protein can complement both Arabidopsis pam68 and pam68l mutants, which would suggest that subfunctionalization occurred after gene duplication in flowering plants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.