Recombinant Arabidopsis thaliana Protein PHLOEM PROTEIN 2-LIKE A10 (PP2A10)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Protein PHLOEM PROTEIN 2-LIKE A10 (PP2A10)

Recombinant Arabidopsis thaliana Protein PHLOEM PROTEIN 2-LIKE A10, referred to here as PP2A10, is a protein derived from the model plant Arabidopsis thaliana. This protein is part of the broader family of proteins involved in various cellular processes, including signaling and regulation within plant tissues. The recombinant form of PP2A10 is produced through biotechnological methods, allowing for its use in research and potential applications in biotechnology.

Production and Characteristics of PP2A10

PP2A10 is produced in various expression systems, including yeast, E. coli, baculovirus, and mammalian cells, depending on the desired characteristics and applications of the protein . This flexibility in production systems allows researchers to tailor the protein's properties, such as purity and stability, to specific experimental needs.

Production SystemCharacteristicsApplications
YeastHigh purity, cost-effectiveBasic research, biotechnology
E. coliRapid production, scalableLarge-scale biotechnology applications
BaculovirusHigh expression levels, complex post-translational modificationsAdvanced biotechnology, vaccine development
Mammalian cellsNative-like post-translational modifications, high complexityPharmaceutical applications, advanced research

Potential Applications of PP2A10

Given the importance of Arabidopsis thaliana as a model organism in plant biology, proteins like PP2A10 could have potential applications in:

  • Biotechnology: Enhancing stress tolerance or improving growth characteristics in crops.

  • Basic Research: Understanding cellular signaling pathways and protein function in plants.

  • Pharmaceuticals: Exploring novel therapeutic targets based on plant-derived proteins.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
PP2A10; At1g10150; F14N23.3; Protein PHLOEM PROTEIN 2-LIKE A10; AtPP2-A10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-414
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PP2A10
Target Protein Sequence
MDLLRLREKGIFLSQRRRKWLIFMAISGVSGYGAYKVYHLPSVARKRKRLFKLFGAIVSV AELISDSAETLSMVSRDVKDFLNSDSDEIPNSLKQIAKITTSNEFTDSLSRVSQAVTIGA FRGYKSESSIGDSGIEKSSDSSVVDRVIDKVFSEAGTGFVSVVVGSFAKNLVLGFYSGKV ESGVKCEGSDSSETPRWVTLLGDDKCRELLADCIERFTSTAIGVYLDKTMDINTYDQIFE GLTNPKHQDSVKDVLVSVCNGALETIVRTSHDVFTSSRSKNVIEEIEDDDFKSNGSARSK MVSESGDGVKSNGWTEAIATTLAVPSNRRFMFDVTGRVTLETTRSIIAFIMVKTFQGFRK SINVVHEEVTDRGRQAVEYVGAKSSVIITVCLALYLHIISGCVRNSPIGVSQHF
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G10150

STRING: 3702.AT1G10150.1

UniGene: At.43478

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the difference between PHLOEM PROTEIN 2-LIKE A10 (PP2A10) and Protein Phosphatase 2A (PP2A)?

While the abbreviation may cause confusion, these are distinct proteins with different functions. PHLOEM PROTEIN 2-LIKE A10 belongs to the phloem protein family involved in phloem structure and function, whereas Protein Phosphatase 2A is a heterotrimeric complex comprising catalytic (C), regulatory (B), and scaffolding (A) subunits that functions as a Ser/Thr phosphatase. The Arabidopsis genome encodes multiple isoforms for each PP2A subunit (3 As, 17 Bs, and 5 Cs) . When working with either protein, researchers should clearly specify which one they are investigating to avoid misinterpretation of results.

What expression patterns are observed for PP2A10 in different Arabidopsis tissues?

PP2A10 expression should be analyzed using multiple complementary approaches:

  • RT-qPCR analysis across different tissues and developmental stages

  • Promoter-reporter fusion constructs (PP2A10pro:GUS or PP2A10pro:GFP) to visualize tissue-specific expression

  • RNA-seq data analysis from public databases such as TAIR or BAR

  • Immunolocalization using specific antibodies if available

Researchers should compare expression data with other phloem-related genes to contextualize the spatiotemporal patterns of PP2A10 expression in vascular tissues.

What are the recommended methods for purifying recombinant PP2A10?

The recommended purification protocol involves:

  • Cloning the full PP2A10 coding sequence into an expression vector with appropriate tags (His, GST, or MBP)

  • Expressing in E. coli (BL21 strain) or insect cell systems for higher eukaryotic protein processing

  • Inducing expression at lower temperatures (16-18°C) to enhance proper folding

  • Cell lysis under native conditions using appropriate buffers (typically containing 20-50 mM Tris-HCl pH 7.5, 100-300 mM NaCl, 5-10% glycerol)

  • Affinity chromatography based on the fusion tag

  • Size exclusion chromatography for final purification

  • Analysis by SDS-PAGE and Western blotting to confirm purity

Researchers should optimize buffer conditions and expression systems based on the specific properties of PP2A10 to maximize yield and activity.

How can I generate and validate PP2A10 knockout lines in Arabidopsis?

Creating and validating knockout lines requires a systematic approach:

  • CRISPR/Cas9 targeting:

    • Design at least 2-3 guide RNAs targeting different regions of the PP2A10 gene

    • Use Arabidopsis-optimized CRISPR/Cas9 vectors

    • Transform via Agrobacterium-mediated floral dip method

  • T-DNA insertion lines:

    • Obtain existing T-DNA insertion lines from stock centers (ABRC, NASC)

    • Screen using PCR-based genotyping with gene-specific and T-DNA border primers

  • Validation steps:

    • Genotyping PCR to confirm mutation

    • RT-qPCR to verify reduced/absent transcript levels

    • Western blotting using specific antibodies to confirm protein absence

    • Complementation with functional PP2A10 to rescue phenotypes

    • Analysis of off-target effects in CRISPR lines

  • Phenotypic characterization:

    • Careful examination of plant development, especially vascular tissues

    • Microscopic analysis of phloem structure

    • Translocation assays using radioactive tracers or fluorescent dyes

What are the best approaches for studying protein-protein interactions involving PP2A10?

Multiple complementary techniques should be employed:

MethodAdvantagesLimitationsKey Considerations
Yeast Two-Hybrid (Y2H)High-throughput screeningProne to false positivesUse appropriate controls; verify interactions with other methods
Co-immunoprecipitation (Co-IP)Detects interactions in native contextRequires specific antibodiesUse mild detergent conditions to preserve interactions
Bimolecular Fluorescence Complementation (BiFC)Visualizes interactions in plantaIrreversible complex formationInclude proper negative controls and analyze subcellular localization
Pull-down assaysTests direct interactionsUses in vitro conditionsEnsure proper protein folding of recombinant proteins
Förster Resonance Energy Transfer (FRET)Real-time interaction dynamicsComplex setup and analysisCareful fluorophore selection and controls for spectral overlap

As demonstrated in studies with Protein Phosphatase 2A, assessing protein interactions with transcription factors like SPCH requires careful experimental design to detect transient interactions . The same principles apply when investigating PP2A10 interaction partners.

How can I develop a specific antibody against PP2A10?

Developing a specific antibody requires:

  • Epitope selection:

    • Analyze the protein sequence for unique regions not conserved in other family members

    • Select 15-20 amino acid peptides from exposed regions

    • Alternative: use recombinant full-length protein as antigen

  • Immunization:

    • Use KLH or BSA conjugated peptides

    • Immunize rabbits or other appropriate host species

    • Follow a standard immunization schedule with boosters

  • Antibody purification:

    • Affinity purification using the antigen

    • Cross-adsorption against related proteins to reduce cross-reactivity

  • Validation:

    • Western blot using wild-type and knockout tissues

    • Immunoprecipitation followed by mass spectrometry

    • Immunolocalization comparing signal in wild-type and knockout plants

    • Peptide competition assays to confirm specificity

How do PP2A10's functions compare with other phloem proteins in Arabidopsis?

Investigating functional relationships requires multiple approaches:

  • Comparative phylogenetic analysis:

    • Align PP2A10 with other phloem proteins

    • Construct phylogenetic trees to identify closely related members

    • Analyze conserved domains and motifs

  • Expression correlation:

    • Analyze co-expression networks from RNA-seq data

    • Identify genes with similar expression patterns across tissues and conditions

  • Mutant phenotype comparison:

    • Compare phenotypes of pp2a10 mutants with other phloem protein mutants

    • Generate double or triple mutants to test for genetic interactions

    • Analyze phenotypes under different environmental conditions

  • Biochemical function analysis:

    • Characterize protein localization and mobility

    • Compare protein-protein interaction networks

    • Evaluate roles in callose deposition and phloem transport

What techniques are most effective for studying PP2A10's role in phloem function?

Effective techniques include:

  • Phloem loading/unloading assays:

    • Use fluorescent dyes (e.g., CFDA) to track phloem transport

    • Employ radioactive tracers (14C-sucrose) for quantitative analysis

    • Compare transport dynamics between wild-type and pp2a10 mutants

  • Graft compatibility studies:

    • Create grafts between wild-type and pp2a10 mutants

    • Analyze phloem reconnection and long-distance signaling

    • Evaluate transport of RNA, proteins, and hormones

  • Phloem sap collection and analysis:

    • Use stylectomy or EDTA-facilitated exudation methods

    • Analyze phloem sap composition by mass spectrometry

    • Compare metabolite and protein profiles between genotypes

  • Real-time imaging:

    • Use PP2A10-GFP fusions to track protein dynamics

    • Employ FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

    • Apply correlative light and electron microscopy for ultrastructural context

How can contradictory data about PP2A10 function be reconciled?

When faced with contradictory results:

  • Critically evaluate experimental conditions:

    • Compare growth conditions, developmental stages, and tissue specificity

    • Analyze genetic backgrounds and potential compensatory mechanisms

    • Consider post-translational modifications affecting protein function

  • Design decisive experiments:

    • Develop tissue-specific or inducible knockout/overexpression lines

    • Use multiple independent lines to rule out insertion effects

    • Employ complementation with site-directed mutants to test mechanistic hypotheses

  • Integrate multiple data types:

    • Combine transcriptomics, proteomics, and metabolomics approaches

    • Analyze global changes in mutant backgrounds

    • Develop mathematical models to reconcile seemingly contradictory data

  • Consider protein complexes:

    • Investigate if PP2A10 functions in different protein complexes

    • Test if environmental conditions affect complex formation

    • Analyze post-translational modifications that might regulate function

How can findings from PP2A10 research in Arabidopsis be translated to crop species?

Translating research requires:

  • Identification of orthologs:

    • BLAST searches against crop genomes

    • Phylogenetic analysis to confirm orthology relationships

    • Domain structure comparison to validate functional conservation

  • Functional conservation testing:

    • Complement Arabidopsis pp2a10 mutants with crop orthologs

    • Create crop CRISPR knockouts based on Arabidopsis phenotypes

    • Compare expression patterns in corresponding tissues

  • Application strategies:

    • Develop molecular markers for breeding programs

    • Create transgenic crops with modified ortholog expression

    • Target upstream regulators identified in Arabidopsis

Similar approaches have been successful in translating other Arabidopsis discoveries to crops. Studies conducted by Corteva Agriscience from 2000 to 2018 used Arabidopsis as a pre-screening platform for candidate genes, testing 35,000 genes identified from Arabidopsis in maize field trials, resulting in 22 promising genes for crop improvement .

What experimental approaches would determine if PP2A10 plays a role in plant stress responses?

A comprehensive stress analysis would include:

  • Expression analysis under stress conditions:

    • Quantify PP2A10 transcript and protein levels under drought, salt, heat, cold, and pathogen stresses

    • Analyze promoter activity using reporter lines under stress

    • Compare with known stress-responsive genes

  • Phenotypic characterization:

    • Evaluate pp2a10 mutant responses to multiple stresses

    • Measure physiological parameters (photosynthesis, transpiration, ROS levels)

    • Assess recovery after stress removal

  • Biochemical interaction changes:

    • Determine if stress alters PP2A10's interaction partners

    • Analyze post-translational modifications under stress

    • Test if stress affects protein stability or localization

  • Grafting experiments:

    • Graft pp2a10 scions to wild-type rootstocks and vice versa

    • Apply stress and analyze systemic responses

    • Determine if PP2A10 affects long-distance stress signaling

How can PP2A10 research contribute to improving plant disease resistance?

Research contributions include:

  • Pathogen response studies:

    • Challenge pp2a10 mutants with diverse pathogens

    • Analyze changes in susceptibility or resistance

    • Examine phloem-based defense responses

  • Defense signaling mechanisms:

    • Test if PP2A10 affects salicylic acid, jasmonic acid, or ethylene pathways

    • Analyze systemic acquired resistance in mutants

    • Investigate interactions with known defense regulators

  • Translational applications:

    • Develop diagnostic markers based on PP2A10 expression changes during infection

    • Create transgenic plants with modified PP2A10 expression

    • Target PP2A10 regulators for enhanced disease resistance

Studies in Arabidopsis have already demonstrated success in translating defense-related discoveries to crops. For example, host-induced gene silencing using RNAi to target the root-knot nematode parasitism gene 16D10 was first demonstrated in Arabidopsis before application in crops .

Why might recombinant PP2A10 show different activity levels between experiments?

Inconsistent activity could result from:

  • Protein folding issues:

    • Test different expression systems (bacterial, yeast, insect cells)

    • Optimize induction conditions (temperature, IPTG concentration)

    • Include molecular chaperones during expression

    • Use fusion tags known to enhance solubility (MBP, SUMO)

  • Post-translational modifications:

    • Analyze purified protein by mass spectrometry to identify modifications

    • Express in eukaryotic systems to allow for proper modification

    • Test the effect of phosphatase or kinase treatment on activity

  • Buffer optimization:

    • Systematically test buffers with different pH values (pH 6.0-8.0)

    • Vary salt concentrations (50-500 mM NaCl)

    • Include stabilizing agents (glycerol, reducing agents)

    • Test different detergents for membrane-associated forms

  • Protein quality control:

    • Analyze batch-to-batch variation by SDS-PAGE and activity assays

    • Implement strict storage protocols to prevent degradation

    • Consider freeze-thaw effects and use fresh preparations when possible

What strategies can resolve PP2A10 antibody cross-reactivity with other phloem proteins?

Cross-reactivity can be addressed by:

  • Antibody purification strategies:

    • Perform affinity purification against the specific antigen

    • Include negative selection against related proteins

    • Use differential adsorption to remove cross-reactive antibodies

  • Epitope refinement:

    • Design new antibodies targeting unique regions of PP2A10

    • Use shorter peptides from highly specific regions

    • Consider monoclonal antibody development for higher specificity

  • Validation with controls:

    • Always include pp2a10 knockout samples as negative controls

    • Use recombinant proteins of related family members to test cross-reactivity

    • Perform peptide competition assays to confirm specificity

  • Alternative approaches:

    • Use epitope-tagged PP2A10 expressed under native promoter

    • Apply proximity labeling methods to avoid antibody limitations

    • Consider CRISPR/Cas9-mediated tagging of endogenous PP2A10

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.