Recombinant Arabidopsis thaliana Protein phosphatase 2C 57 (PPH1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PPH1; PP2C57; TAP38; At4g27800; T27E11.40; Protein phosphatase 2C 57; AtPP2C57; Protein phosphatase 2C PPH1; PP2C PPH1; Thylakoid-associated phosphatase of 38 kDa
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PPH1
Target Protein Sequence
MALLRPHLHRFHSNTLRHSAYPSADAGGGLVVYPTYGRHRCSAIAIDAPSSLTGVTPIRW GYTSVQGFRDEMEDDIVIRSDAVDSFSYAAVFDGHAGSSSVKFLREELYKECVGALQAGS LLNGGDFAAIKEALIKAFESVDRNLLKWLEANGDEEDESGSTATVMIIRNDVSFIAHIGD SCAVLSRSGQIEELTDYHRPYGSSRAAIQEVKRVKEAGGWIVNGRICGDIAVSRAFGDIR FKTKKNDMLKKGVDEGRWSEKFVSRIEFKGDMVVATPDIFQVPLTSDVEFIILASDGLWD YMKSSDVVSYVRDQLRKHGNVQLACESLAQVALDRRSQDNISIIIADLGRTEWKNLPAQR QNVVVELVQAATTIGLVTVGIWMSSHLS
Uniprot No.

Target Background

Function
Protein phosphatase crucial for efficient dephosphorylation of the light-harvesting complex II outer antennae (LHCII), facilitating the transition from state 2 to state 1. This state transition is central to the plant's response to environmental changes, enabling rapid adjustment to fluctuating light conditions by redistributing light excitation energy between photosystem II (PSII) and photosystem I (PSI) through LHCII protein relocation. Primarily responsible for dephosphorylating Lhcb1 and Lhcb2, but not photosystem II core proteins.
Gene References Into Functions
  1. The inability of the psal mutant to bind pLHCII to PSI causes excessive LHCII phosphorylation, mainly due to post-transcriptional downregulation of the TAP38/PPH1 phosphatase. PMID: 26926011
  2. TAP38 is essential for LHCII dephosphorylation and the state 2 to state 1 transition in A. thaliana. PMID: 20126264
  3. Loss of PPH1 leads to increased photosystem I antenna size and severely impaired state transitions. PMID: 20176943
  4. A comparative genomic analysis of the PP2C family in Arabidopsis and rice offers insights into their functions and regulatory mechanisms. PMID: 19021904
Database Links

KEGG: ath:AT4G27800

STRING: 3702.AT4G27800.1

UniGene: At.23824

Protein Families
PP2C family
Subcellular Location
[Isoform 1]: Membrane; Single-pass membrane protein.; [Isoform 2]: Plastid, chloroplast stroma.

Q&A

What is Arabidopsis thaliana Protein Phosphatase 2C 57 (PPH1) and what are its alternative names?

PPH1 is a type 2C protein phosphatase found in Arabidopsis thaliana, also known as TAP38 (thylakoid-associated phosphatase 38). It is encoded by genes alternatively annotated as PPH1, TAP38, PROTEIN PHOSPHATASE 1, T27E11.40, or T27E11_40 . The protein functions as a serine/threonine phosphatase with catalytic activity classified under EC 3.1.3.16 . Unlike many other phosphatases, PPH1 has a unique subcellular localization pattern that contributes to its specific biological functions in plant metabolism.

What is the molecular weight and structure of recombinant PPH1?

Recombinant PPH1 protein from Arabidopsis thaliana is typically identified as a protein with a molecular weight of approximately 45.2 kDa as determined by SDS-PAGE analysis . The protein contains the conserved catalytic domain characteristic of type 2C protein phosphatases. When expressed recombinantly, PPH1 can be produced with at least 85% purity as determined by SDS-PAGE . The protein structure includes regions responsible for its catalytic activity and unique targeting sequences that direct its subcellular localization.

How does PPH1 relate to other PP2C family members in Arabidopsis?

PPH1 belongs to the broader PP2C family in Arabidopsis thaliana, which contains multiple members organized into distinct clades based on sequence homology. While many PP2Cs from group A (including members like ABI1, ABI2, HAB1, and HAB2) are well-characterized as negative regulators of abscisic acid (ABA) signaling , PPH1 has distinctive properties and subcellular targeting that differentiate it from these better-studied family members. The Arabidopsis genome contains numerous PP2C genes that are arranged in clades based on sequence alignment of their catalytic phosphatase cores . PPH1's functional specialization reflects the evolutionary diversification of phosphatases to regulate different aspects of plant physiology.

What is the subcellular localization pattern of PPH1 and how is it determined experimentally?

PPH1 exhibits a dual-targeting pattern, localizing to both plastids (chloroplasts) and mitochondria . This dual localization is directed by a C-terminal hydrophobic motif that serves as a targeting signal . To determine this localization experimentally, researchers typically employ techniques such as:

  • Fluorescent protein fusion constructs (GFP/YFP-PPH1) for live-cell imaging

  • Immunofluorescence using anti-PPH1 antibodies

  • Subcellular fractionation followed by western blotting

  • Protease protection assays with isolated organelles

The experimental verification of dual localization requires careful controls, including co-localization with known plastid and mitochondrial markers, and comparison with truncated PPH1 lacking the C-terminal targeting sequence .

How does the C-terminal motif of PPH1 influence its function?

The C-terminal hydrophobic motif of PPH1 is essential for its biological function. Experimental evidence has shown that truncated versions of PPH1 lacking this motif fail to localize properly and consequently cannot perform their native biological activities . This has been demonstrated through ectopic expression of truncated PPH1 in Arabidopsis, which revealed that the subcellular localization mediated by the C-terminal motif is essential for its biological actions . The dual targeting capability mediated by this region represents an evolutionary adaptation that allows a single protein to function in two distinct organelles, potentially coordinating their activities in response to cellular needs.

What are the primary physiological roles of PPH1 in Arabidopsis?

PPH1/TAP38 plays crucial roles in:

  • Carbon metabolism regulation: Similar to other dual-targeted phosphatases like AtPAP2, PPH1 appears to modulate carbon metabolism in plants . This function may involve regulation of key metabolic enzymes through dephosphorylation.

  • Photosynthetic regulation: As a thylakoid-associated phosphatase, PPH1 likely regulates photosynthetic processes through protein dephosphorylation in chloroplasts.

  • Energy homeostasis: Through its dual localization to both energy-producing organelles (mitochondria and chloroplasts), PPH1 may coordinate energy production and utilization in response to environmental conditions.

The diverse functions of PPH1 reflect its strategic positioning at the interface of major metabolic pathways in plants.

How does PPH1 differ from other PP2Cs involved in ABA signaling?

While many group A PP2Cs (such as ABI1, ABI2, HAB1, and HAB2) function primarily as negative regulators of ABA signaling , PPH1 appears to have more specialized roles in carbon metabolism and organellar function. The key differences include:

  • Subcellular localization: Unlike ABA-related PP2Cs that function in the cytosol or nucleus, PPH1 is dual-targeted to plastids and mitochondria .

  • Substrate specificity: PPH1 likely targets different substrate proteins compared to ABA-related PP2Cs, which interact with and dephosphorylate SnRK2 protein kinases .

  • Physiological outcomes: While ABA-related PP2Cs regulate stress responses and developmental processes like seed germination and stomatal closure , PPH1 appears more involved in basic metabolic regulation and energy homeostasis.

These functional differences highlight the diversification of the PP2C family to regulate distinct aspects of plant physiology.

What expression systems are most effective for producing recombinant PPH1?

Recombinant PPH1 can be successfully expressed in multiple systems, each with specific advantages:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliRapid growth, high yield, economicalMay lack post-translational modifications5-10 mg/L culture
YeastEukaryotic processing, moderate yieldLonger expression time than bacteria2-5 mg/L culture
BaculovirusInsect cell expression, good foldingComplex system, higher cost1-3 mg/L culture
Mammalian cellsMost authentic modificationsHighest cost, lowest yield0.5-2 mg/L culture
Cell-free expressionRapid, avoids toxicity issuesLimited scale, expensiveVariable

According to product information, recombinant PPH1 can be expressed in E. coli, yeast, baculovirus, or mammalian cell systems with at least 85% purity as determined by SDS-PAGE . For functional studies requiring proper folding and activity, eukaryotic expression systems may be preferable despite their higher cost and complexity.

What purification strategies yield the highest activity for recombinant PPH1?

Optimal purification of recombinant PPH1 typically involves:

  • Affinity chromatography: Using His-tag, GST-tag, or other fusion partners for initial capture

  • Ion exchange chromatography: For removal of contaminating proteins

  • Size exclusion chromatography: For final polishing and buffer exchange

To maintain PPH1 activity during purification, consider these critical factors:

  • Include phosphatase inhibitors (except those targeting PP2Cs) in initial lysis buffers

  • Maintain reducing conditions (1-5 mM DTT or β-mercaptoethanol)

  • Keep samples cold (4°C) throughout the purification process

  • Include glycerol (10-20%) in storage buffers to maintain stability

  • Avoid repeated freeze-thaw cycles of purified protein

Purification to ≥85% homogeneity is generally sufficient for functional studies, though higher purity may be required for structural analyses .

What are the optimal assay conditions for measuring PPH1 phosphatase activity?

For robust measurement of PPH1 phosphatase activity:

Buffer composition:

  • 50 mM Tris-HCl or HEPES, pH 7.0-7.5

  • 10-20 mM MgCl₂ (PP2Cs are Mg²⁺-dependent)

  • 0.1-1 mM DTT or β-mercaptoethanol

  • 0.02-0.05% non-ionic detergent (for stability)

Substrate options:

  • Generic phosphatase substrates (p-nitrophenyl phosphate)

  • Phosphopeptides based on known or predicted substrates

  • ³²P-labeled proteins for highly sensitive detection

Activity measurement methods:

  • Colorimetric assays (for p-nitrophenyl phosphate)

  • Malachite green phosphate detection assay

  • Mass spectrometry for site-specific dephosphorylation analysis

When comparing different PP2C family members, standardized conditions should be employed to ensure valid comparisons of catalytic efficiency.

How can PPH1 be used to study organellar crosstalk in plant cells?

The dual localization of PPH1 to both chloroplasts and mitochondria makes it an excellent model for studying inter-organellar communication. Research approaches include:

  • Differential targeting studies: Creating variants with altered targeting efficiency to one organelle versus the other to dissect organelle-specific functions

  • Metabolic flux analysis: Measuring changes in metabolite exchange between organelles in PPH1 mutants or overexpression lines

  • Phosphoproteomics: Comparing the phosphorylation states of proteins in both organelles when PPH1 levels are altered

  • Environmental response studies: Analyzing how PPH1 mediates coordination between organelles under different stress conditions

Such studies can provide insights into how plants coordinate energy production and carbon metabolism across different cellular compartments. The dual targeting of PPH1 via its C-terminal motif represents an evolutionary adaptation that potentially allows coordination of activities between these two energy-producing organelles .

What techniques can be used to identify physiological substrates of PPH1?

Identifying the authentic substrates of PPH1 requires multiple complementary approaches:

  • Substrate-trapping mutants: Creating catalytically inactive PPH1 variants that bind but do not release substrates

  • Proximity-dependent labeling: Using PPH1 fused to enzymes like BioID or TurboID to identify proteins in its vicinity

  • Co-immunoprecipitation with phosphoproteomic analysis: Pulling down PPH1 complexes followed by mass spectrometry

  • Comparative phosphoproteomics: Analyzing phosphorylation changes in wild-type versus pph1 mutant plants

  • In vitro validation: Testing candidate substrates with recombinant PPH1 to confirm direct dephosphorylation

These approaches have been successfully applied to other PP2Cs where direct interactions with substrates have been demonstrated, such as the interaction between group A PP2Cs (ABI1, ABI2, HAB1) and ACS7 in ethylene biosynthesis regulation .

How can structural biology approaches advance our understanding of PPH1 function?

Structural biology offers powerful insights into PPH1 function through:

  • X-ray crystallography or cryo-EM: Determining the three-dimensional structure of PPH1 alone or in complex with substrates

  • Molecular modeling: Using homology models based on related PP2Cs to predict interaction interfaces

  • Structure-guided mutagenesis: Testing the importance of specific residues for catalysis or substrate binding

  • Hydrogen-deuterium exchange mass spectrometry: Mapping conformational changes upon substrate binding

Previous studies have successfully used molecular modeling to predict amino acid residues involved in protein-protein interactions of related PP2Cs, such as the ABI1/ACS7 complex, with subsequent confirmation by techniques like mcBiFC–FRET–FLIM analysis . Similar approaches could illuminate PPH1's mode of action and substrate specificity.

What phenotypes are associated with PPH1 mutants or overexpression lines?

Alterations in PPH1 expression levels can lead to various phenotypic changes:

In loss-of-function mutants:

  • Potential disruptions in carbon metabolism

  • Alterations in photosynthetic efficiency

  • Changes in stress responses

In overexpression lines:

  • Potential phenotypes similar to those observed with other dual-targeted phosphatases like AtPAP2, which include:

    • Earlier bolting

    • Higher seed yield

    • Altered sugar and tricarboxylic acid (TCA) metabolite levels

The precise phenotypic consequences would depend on the specific substrates and pathways regulated by PPH1. By comparison, overexpression of the dual-targeted phosphatase AtPAP2 (which also targets both plastids and mitochondria) results in faster growth and higher seed yield, suggesting that dual-targeted phosphatases can significantly impact plant productivity .

What are the most effective approaches for creating and validating PPH1 mutants?

Creating reliable PPH1 mutants requires careful experimental design:

  • CRISPR/Cas9 gene editing:

    • Design guide RNAs targeting exonic regions

    • Screen for frameshift mutations

    • Validate by sequencing

  • T-DNA insertion lines:

    • Screen available repositories (SALK, SAIL, GABI-Kat)

    • Confirm insertion sites by PCR and sequencing

    • Verify reduced transcript/protein levels

  • RNAi or artificial microRNA approaches:

    • Design constructs to specifically target PPH1

    • Create transgenic lines

    • Quantify knockdown efficiency

Validation methods:

  • RT-qPCR for transcript levels

  • Western blotting with anti-PPH1 antibodies

  • Phosphatase activity assays

  • Complementation tests with wild-type PPH1

For generating overexpression lines, consider using inducible promoters to avoid potential developmental abnormalities associated with constitutive overexpression.

How conserved is PPH1 across plant species and what does this suggest about its evolutionary importance?

The evolutionary conservation of PPH1-like proteins provides insights into their fundamental importance in plant physiology:

  • PPH1-like sequences with C-terminal hydrophobic motifs have been identified even in primitive photosynthetic eukaryotes like Ostreococcus tauri, suggesting an ancient and conserved function in regulating carbon metabolism .

  • The dual-targeting mechanism mediated by the C-terminal motif appears to be an evolutionarily conserved feature, suggesting selective pressure to maintain this function.

  • Comparative analysis across plant species can reveal:

    • Core conserved domains likely essential for catalytic function

    • Variable regions that might confer species-specific regulation

    • Conservation of potential substrate interaction sites

The presence of similar dual-targeted phosphatases in diverse photosynthetic organisms underscores their fundamental role in coordinating energy metabolism between plastids and mitochondria throughout plant evolution .

How does PPH1 compare functionally to other dual-targeted proteins in plants?

PPH1 shares functional similarities with other dual-targeted proteins:

ProteinLocalizationFunctionPhenotypic Impact
PPH1/TAP38Chloroplasts, MitochondriaPhosphatase activityMetabolic regulation
AtPAP2Chloroplasts, MitochondriaPurple acid phosphataseEnhanced growth, higher seed yield
Dual-targeted kinasesVariesPhosphorylationVarious metabolic effects
Redox proteinsVarious organellesRedox regulationStress response, signaling

The dual targeting of these proteins represents an efficient evolutionary strategy to coordinate activities across different organelles. AtPAP2, like PPH1, contains a C-terminal hydrophobic motif essential for its dual targeting and biological function . This shared feature suggests common mechanisms for dual targeting and potentially overlapping roles in coordinating organellar activities.

How might PPH1 interact with ABA signaling pathways?

While PPH1 may not be directly involved in ABA signaling like group A PP2Cs (ABI1, ABI2, HAB1), potential indirect interactions may exist:

  • Group A PP2Cs are key negative regulators of ABA signaling and interact with SnRK2 protein kinases through physical interactions, inactivating them via dephosphorylation .

  • PPH1's role in metabolic regulation might influence cellular energy status, which could indirectly affect hormone signaling pathways including ABA responses.

  • Potential research approaches to investigate these interactions include:

    • Analyzing PPH1 expression in response to ABA treatment

    • Examining ABA sensitivity in pph1 mutants

    • Testing for genetic interactions between PPH1 and known ABA signaling components

Understanding these potential interactions could reveal how plants integrate metabolic status with hormone signaling networks.

What techniques can be used to study PPH1's role in carbon metabolism?

To investigate PPH1's role in carbon metabolism:

  • Metabolomic analysis:

    • Compare metabolite profiles between wild-type and pph1 mutant plants

    • Focus on sugar, starch, and TCA cycle intermediates

    • Use techniques like GC-MS or LC-MS for comprehensive coverage

  • Enzyme activity assays:

    • Measure activities of key carbon metabolism enzymes

    • Assess sucrose phosphate synthase (SPS) activity, which has been shown to be regulated in other contexts involving dual-targeted phosphatases

    • Compare phosphorylation states of these enzymes

  • Carbon flux analysis:

    • Use isotope labeling (¹³C, ¹⁴C) to track carbon movement

    • Measure assimilation and allocation patterns

    • Determine how PPH1 affects carbon partitioning

Similar approaches with the dual-targeted phosphatase AtPAP2 revealed that its overexpression resulted in higher levels of sugars and TCA metabolites, along with significantly upregulated sucrose phosphate synthase activity .

What statistical approaches are most appropriate for analyzing PPH1-related experimental data?

When designing and analyzing experiments involving PPH1:

  • For gene expression studies:

    • Use appropriate reference genes for RT-qPCR normalization

    • Apply two-factor ANOVA for experiments involving multiple variables

    • Consider FDR correction for multiple testing when analyzing large datasets

  • For phenotypic analyses:

    • Employ mixed linear models for complex experimental designs

    • Use appropriate post-hoc tests for multiple comparisons

    • Consider blocked experimental designs to control for environmental variation

  • For phosphoproteomic data:

    • Apply specialized statistical frameworks for mass spectrometry data

    • Consider both abundance and phosphorylation site occupancy

    • Use appropriate normalization methods for global phosphorylation changes

How can researchers address potential experimental artifacts when studying recombinant PPH1?

To ensure reliable results with recombinant PPH1:

  • Expression system considerations:

    • Be aware that different expression systems may yield proteins with varying post-translational modifications

    • Validate protein activity regardless of expression system

    • Consider testing multiple expression systems for critical experiments

  • Protein quality control:

    • Assess protein homogeneity by size-exclusion chromatography

    • Verify proper folding using circular dichroism

    • Test batch-to-batch consistency in activity assays

  • Experimental controls:

    • Include catalytically inactive mutants as negative controls

    • Use closely related PP2Cs to assess specificity

    • Validate antibody specificity with knockout/knockdown samples

  • Replication strategies:

    • Perform biological replicates (different protein preparations)

    • Include technical replicates to assess method reliability

    • Consider inter-laboratory validation for key findings

Careful attention to these factors will minimize artifacts and ensure reproducible results in PPH1 research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.