Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 10 (PCR10)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 10 (PCR10)

Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 10 (PCR10) is a recombinant protein derived from the model plant Arabidopsis thaliana. This protein is associated with cadmium resistance and is produced through recombinant DNA technology, allowing for its expression in various host organisms such as yeast, Escherichia coli, or baculovirus systems . The recombinant production of PCR10 facilitates its use in research and applications related to heavy metal tolerance and plant stress responses.

Protein Structure and Sequence

  • Amino Acid Sequence: The amino acid sequence of PCR10 is detailed, providing insights into its structural and functional properties. The sequence includes motifs that may be crucial for its role in cadmium resistance .

  • Molecular Weight and Size: While specific molecular weight details are not provided, the protein is available in various sizes, typically starting at 50 μg .

Expression and Production

  • Host Organisms: PCR10 can be produced in yeast, E. coli, or using the baculovirus system, offering flexibility in production methods .

  • Purification and Storage: The protein is purified to high standards and stored in a Tris-based buffer with 50% glycerol, typically at -20°C to maintain stability .

Function and Role

  • Cadmium Resistance: PCR10 is implicated in enhancing plant resistance to cadmium, a toxic heavy metal. Its exact mechanism of action may involve sequestration or detoxification pathways.

  • Stress Response: Beyond cadmium, PCR10 may play roles in broader stress responses, contributing to plant resilience against various environmental challenges.

Cadmium Tolerance Mechanisms

  • Studies on PCR10 could reveal novel pathways for cadmium detoxification in plants, potentially informing strategies for phytoremediation or improving crop resilience in polluted soils.

  • The interaction of PCR10 with other stress-related proteins may highlight complex regulatory networks in plant stress responses.

Biotechnological Applications

  • Genetic Engineering: PCR10 could be used to engineer crops with enhanced heavy metal resistance, improving agricultural productivity in contaminated areas.

  • Environmental Remediation: By understanding how PCR10 functions, scientists may develop more effective methods for cleaning polluted environments using plants.

PCR10 Protein Details

ParameterDescription
Protein NamePLANT CADMIUM RESISTANCE 10 (PCR10)
Gene NamePCR10
Ordered Locus NamesAt2g40935
Expression Region1-190
Source OrganismArabidopsis thaliana
Production HostsYeast, E. coli, Baculovirus
Storage Conditions-20°C, Tris-based buffer with 50% glycerol

Production and Availability

CodeSourceSizeNotes
CSB-YP851422DOA1YeastInquireHigh purity
CSB-EP851422DOA1E. coliInquireStandard production
CSB-EP851422DOA1-BE. coliInquireBiotinylated using AviTag-BirA technology
CSB-BP851422DOA1BaculovirusInquireHigh expression levels

References Recombinant production of the p10CKS1At protein from Arabidopsis thaliana. Identification of stably expressed reference genes for Arabidopsis thaliana. A novel Arabidopsis thaliana protein, ABAP1 INTERACTING PROTEIN 10 (AIP10). Transcriptome Analysis of Arabidopsis thaliana in Response to P. brassicae. Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 10 (PCR10). Selecting Accurate Reference Genes for qPCR Expression Analysis in A. thaliana. Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 10 (PCR10), partial.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PCR10; At2g40935; T20B5; Protein PLANT CADMIUM RESISTANCE 10; AtPCR10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PCR10
Target Protein Sequence
MKEKKGHYVPPSYIPLTQSDADTEVETTTPNLEIAVSESTKDDPRQWSSGICACFDDMQS CCVGLFCPCYIFGKNAELLGSGTFAGPCLTHCISWALVNTICCFATNGALLGLPGCFVSC YACGYRKSLRAKYNLQEAPCGDFVTHFFCHLCAICQEYREIREQSSGSYPLDMKMAITNA PLAQTMESAN
Uniprot No.

Target Background

Function
Potentially involved in cadmium resistance.
Database Links

KEGG: ath:AT2G40935

STRING: 3702.AT2G40935.1

UniGene: At.66415

Protein Families
Cornifelin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What molecular pathways are involved in cadmium resistance in Arabidopsis thaliana?

Cadmium resistance in Arabidopsis thaliana involves multiple interconnected pathways with abscisic acid (ABA) playing a central role as a stress hormone. ABA induces different signaling pathways that help plants resist cadmium stress through several mechanisms:

  • Accumulation of protective compounds such as proline, small hydrophilic proteins, and sugars

  • Activation of detoxification mechanisms that maintain redox balance

  • Modification of ion transport to re-establish homeostasis

  • Regulation of stress-induced transcription factors and their target genes

Wild-type Arabidopsis (Col-0) demonstrates significantly higher resistance to cadmium compared to ABA-deficient mutants like bglu10 and bglu18, indicating the essential role of ABA in cadmium tolerance mechanisms .

How do vacuolar mechanisms contribute to cadmium sequestration in Arabidopsis?

Vacuolar sequestration represents a critical mechanism for cadmium detoxification in Arabidopsis. The process involves:

  • Enhanced activity of vacuolar proton pumps (V-ATPase and V-PPase) in cadmium-resistant plants

  • Higher proton pump activity in wild-type Arabidopsis compared to ABA-deficient mutants

  • Active transport of cadmium ions into vacuoles, reducing cytoplasmic cadmium concentration

Research shows that Col-0 wild-type plants, which display greater resistance to cadmium, exhibit higher V-ATPase and V-PPase activities, enabling more efficient sequestration of cadmium in root cell vacuoles. This results in lower cytoplasmic cadmium levels and reduced toxicity to cellular processes .

What are the recommended protocols for expressing and purifying recombinant PCR10 protein?

When expressing recombinant Arabidopsis proteins for functional studies:

  • Expression system selection: E. coli BL21(DE3) typically provides good yields for plant proteins with proper folding.

  • Vector optimization:

    • Include N-terminal or C-terminal tags (His6, GST) for purification

    • Consider codon optimization for the expression host

    • Incorporate TEV protease cleavage sites if tag removal is needed

  • Direct PCR screening methods:

    • The CutTip method involves stabbing a pipette tip into Arabidopsis tissue and transferring the tip directly into PCR reaction buffer

    • Line-PCR employs short segments of fishing line to collect plant material for PCR analysis

    • Both methods eliminate the need for DNA purification while maintaining high accuracy

  • Purification approach:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Size exclusion chromatography for removing aggregates

    • Activity assays to confirm proper folding and function

How can gene targeting be optimized when studying cadmium resistance proteins in Arabidopsis?

Gene targeting (GT) efficiency in Arabidopsis remains challenging but can be significantly improved through the following approaches:

  • CRISPR/Cas9-mediated targeting:

    • Implement surrogate screening methods using endogenous markers

    • Employ the MAR1 gene (conferring kanamycin resistance) as a selectable marker

    • Use a double-step screening strategy to increase GT efficiency up to four-fold

  • Homology-directed repair optimization:

    • Design donor templates with extended homology arms (≥500 bp)

    • Incorporate sequence-specific nucleases to create targeted double-strand breaks

    • Balance between error-prone non-homologous end-joining (NHEJ) and error-free homology-directed repair (HDR)

  • Selection strategies:

    • Implement positive-negative selection schemes

    • Use endogenous markers for initial screening

    • Confirm targeted integration through PCR and sequencing

How do ubiquitination pathways interact with cadmium resistance mechanisms?

Ubiquitination pathways play significant roles in regulating cadmium stress responses in Arabidopsis through several mechanisms:

  • Ubiquitin-conjugating enzyme variants (UEVs):

    • Proteins like COP10 encode UEV proteins that can interact with the ubiquitination machinery

    • These proteins may target key regulators of stress responses for degradation

  • Protein complexes and interactions:

    • COP10 forms part of a nuclear protein complex

    • It directly interacts with both COP1 (a potential ubiquitin ligase) and the COP9 signalosome

    • These interactions suggest a coordinated ubiquitination pathway that may regulate stress responses

  • Ubiquitin-like domain kinases:

    • AtPI4Kgamma4 and AtPI4Kgamma7 contain N-terminal ubiquitin-like (UBL) domains

    • These proteins interact with components of the ubiquitin-proteasome system such as UFD1 and RPN10

    • They phosphorylate these proteins, providing an additional regulatory mechanism

The ubiquitination system likely facilitates the removal of damaged proteins during cadmium stress and regulates the stability of key transcription factors and signaling proteins involved in stress responses.

What is the interplay between nitrate transporters and cadmium resistance in Arabidopsis?

Nitrate transporters play unexpected but significant roles in cadmium resistance through:

  • Differential regulation under stress:

    • NRT1.5 expression is downregulated in response to ABA signaling during cadmium stress

    • NRT1.8 expression remains unaffected by ABA during cadmium stress

    • This differential regulation results in altered nitrate distribution patterns

  • Root accumulation of nitrate:

    • The combined action of NRT1.5 downregulation and stable NRT1.8 expression leads to increased nitrate retention in roots

    • Enhanced root nitrate levels correlate with improved cadmium resistance

  • Quantitative relationships:

    GenotypeRoot/Shoot NO₃⁻ Ratio (Control)Root/Shoot NO₃⁻ Ratio (Cd stress)Root/Shoot Cd²⁺ Ratio
    Col-0 (WT)0.40 ± 0.050.85 ± 0.072.45 ± 0.20
    bglu100.38 ± 0.040.55 ± 0.061.60 ± 0.15
    bglu180.37 ± 0.040.58 ± 0.051.65 ± 0.18

    This data demonstrates that wild-type plants accumulate significantly more nitrate and cadmium in roots under stress conditions compared to ABA-deficient mutants .

How do vacuolar proton pumps influence cadmium compartmentalization and tolerance?

Vacuolar proton pumps are critical determinants of cadmium tolerance through their role in compartmentalization:

  • Proton pump activity and cadmium sequestration:

    • V-ATPase and V-PPase activities are significantly higher in cadmium-resistant wild-type plants

    • These pumps establish the proton gradient necessary for secondary active transport of cadmium into vacuoles

    • Enhanced activity correlates with reduced cytoplasmic cadmium levels

  • Compartmentalization efficiency:

    • Wild-type Arabidopsis shows higher capacity for vacuolar cadmium sequestration

    • Lower cytoplasmic cadmium concentrations in wild-type compared to ABA-deficient mutants

    • Vacuolar sequestration prevents cadmium from interfering with essential cellular processes

  • Trade-offs with nitrogen use efficiency:

    • Enhanced vacuolar proton pump activity leads to increased nitrate accumulation in root vacuoles

    • This results in less nitrate transport to shoots and reduced nitrogen use efficiency (NUE)

    • Revealing a trade-off between stress resistance and nutrient utilization efficiency

What are the technical challenges in studying recombinant cadmium resistance proteins?

Researchers face several technical challenges when working with recombinant cadmium resistance proteins:

  • Protein stability and solubility:

    • Membrane-associated cadmium transporters often present solubility challenges

    • Optimization of expression conditions (temperature, induction time, media composition)

    • Use of solubility-enhancing fusion partners (MBP, SUMO, TrxA)

  • Functional assays and activity measurement:

    • Development of robust in vitro assays for cadmium transport or sequestration

    • Integration of metal-binding assays with structural studies

    • Correlation of in vitro findings with in vivo phenotypes

  • Direct PCR screening optimization:

    • CutTip and Line-PCR methods provide accurate results without visible tissue fragments

    • These methods are faster, less expensive, and cause minimal tissue damage compared to traditional approaches

    • They require no modified PCR reagents and minimize experimental complications

How does ABA signaling enhance cadmium tolerance at the molecular level?

ABA signaling enhances cadmium tolerance through multiple coordinated mechanisms:

  • Signaling cascade activation:

    • ABA accumulation in response to cadmium stress

    • Activation of specific transcription factors and downstream regulatory elements

    • Induction of stress-protective genes

  • Nitrate transporter regulation:

    • ABA-mediated downregulation of NRT1.5 expression

    • Unaltered expression of NRT1.8

    • This differential regulation increases root nitrate retention and enhances cadmium resistance

  • Proton pump activation:

    • Higher V-ATPase and V-PPase activities in wild-type plants with normal ABA production

    • Enhanced accumulation of nitrate and cadmium in root vacuoles

    • Reduced cadmium toxicity through effective compartmentalization

  • Protective compound accumulation:

    • Increased proline levels in response to cadmium stress (specifically in wild-type plants)

    • Reduced malondialdehyde (MDA) accumulation, indicating lower oxidative damage

    • Enhanced cellular protection against cadmium-induced stress

What are emerging approaches for enhancing cadmium resistance in crop plants?

Several emerging approaches show promise for enhancing cadmium resistance in agricultural crops:

  • Genetic engineering strategies:

    • Targeted modification of key genes involved in cadmium uptake, transport, and sequestration

    • CRISPR/Cas9-mediated gene editing to enhance existing resistance mechanisms

    • Introduction of novel cadmium resistance genes from other species

  • Hormone modulation approaches:

    • Exogenous application of ABA to enhance natural resistance mechanisms

    • In Brassica napus, exogenous ABA application inhibits cadmium absorption

    • Strategic hormone treatments during key developmental stages

  • Nitrate management strategies:

    • Manipulation of nitrate transporters to enhance root cadmium sequestration

    • Optimizing nitrogen fertilization regimes to maximize cadmium resistance

    • Balancing the trade-off between stress resistance and nitrogen use efficiency

  • Future research directions:

    • Integration of transcriptomics and metabolomics to identify novel resistance factors

    • Exploration of interactions between cadmium resistance and other abiotic stress response mechanisms

    • Development of crop varieties with enhanced heavy metal resistance for phytoremediation applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.