Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 11 (PCR11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
PCR11; At1g68610; F24J5.15; Protein PLANT CADMIUM RESISTANCE 11; AtPCR11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PCR11
Target Protein Sequence
MNLSSNDQPSQGRIKAKDWSTDLCECWMDINSCCLTCWCPCVAFGRIAEVVDRGSTSCGV SGAMYMIIFMLTGYGGSSLYSCFYRTKLRAQYNLKERPCCDCCVHFCCEPCALCQEYRQL QHNRDLDLVIGWHGNMERHARLAASTPSAPPLQAPMSRLV
Uniprot No.

Target Background

Function
Putative involvement in heavy metal transport.
Database Links

KEGG: ath:AT1G68610

STRING: 3702.AT1G68610.1

UniGene: At.52437

Protein Families
Cornifelin family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is PCR11 and how is it related to the PCR gene family?

PCR11 (PLANT CADMIUM RESISTANCE 11) is a retrogene in Arabidopsis thaliana that originated from its parent gene PCR2 through a retrotransposition event. As a retrogene, PCR11 was formed when the mRNA of PCR2 was reverse transcribed into cDNA and subsequently integrated into the genome . The PCR gene family in plants is involved in heavy metal resistance mechanisms, particularly for cadmium (Cd) detoxification. Unlike many duplicated genes that become pseudogenes, PCR11 has gained novel expression patterns specifically in sperm cells, suggesting functional specialization following its formation .

What is the structural composition of the PCR11 protein?

The full-length Arabidopsis thaliana PCR11 protein consists of 160 amino acids (positions 1-160) and is cataloged in the UniProt database with the identifier Q9SX24 . The protein likely contains transmembrane domains that facilitate metal ion transport across cellular membranes, similar to other members of the PCR family. When produced as a recombinant protein for research purposes, it is often expressed with an N-terminal histidine tag in E. coli expression systems to facilitate purification via metal affinity chromatography .

How does PCR11 differ from its parent gene PCR2 in terms of expression patterns?

Studies have revealed that PCR11 has evolved a distinct expression pattern compared to its parent gene PCR2. While PCR2 shows broader expression across plant tissues, PCR11 has acquired sperm cell-specific expression. This specialization is regulated by the DUO1 transcription factor, which activates PCR11 expression in sperm cells . In experimental conditions where DUO1 was induced, PCR11 showed significant upregulation (log2-fold changes of 0.26, 2.21, and 4.03 at 6, 12, and 24 hours, respectively; p-values: 0.010, 3.3×10^-5, and 5.4×10^-5) . Interestingly, this upregulation of PCR11 was accompanied by concurrent downregulation of its parent gene PCR2, demonstrating a potential regulatory relationship between these genes in reproductive tissues .

What are the optimal methods for studying PCR11 expression levels?

For studying PCR11 expression levels, quantitative real-time PCR (qRT-PCR) is the method of choice due to its sensitivity and specificity. When designing qRT-PCR experiments for PCR11, researchers should implement an efficient experimental design that reduces the number of sample reactions while maintaining statistical robustness . Rather than using identical replicates as in traditional designs, a dilution-replicate approach is recommended where a single reaction is performed on several dilutions for each test sample .

For data analysis, the cycle threshold (Ct) method can be used to quantify PCR11 transcript levels. Studies have shown that primer pair-specific Ct values are highly reproducible, with standard deviations typically less than 0.2 PCR cycles across independent measurements . This precision allows for reliable comparison of PCR11 expression across different experimental conditions or tissue types.

How can recombinant PCR11 protein be produced and purified for functional studies?

For functional studies of PCR11, the recombinant protein can be produced using prokaryotic expression systems, typically E. coli, with an N-terminal histidine tag to facilitate purification . The general protocol involves:

  • Cloning the full-length PCR11 coding sequence (nucleotides encoding amino acids 1-160) into an expression vector with an N-terminal His-tag

  • Transforming the construct into an E. coli expression strain

  • Inducing protein expression under optimized conditions

  • Lysing the bacteria and purifying the recombinant protein using nickel affinity chromatography

  • Verifying protein identity and purity through SDS-PAGE and Western blotting

For functional characterization, researchers should consider conducting metal binding assays, subcellular localization studies, and complementation experiments in PCR11-deficient Arabidopsis lines to evaluate the protein's role in cadmium resistance.

What experimental designs are recommended for studying PCR11 function in planta?

To study PCR11 function in planta, several experimental approaches are recommended:

ApproachMethodologyKey Considerations
Knockout/knockdown studiesCRISPR-Cas9 genome editing or T-DNA insertion linesVerify complete loss of PCR11 expression; account for potential redundancy with other PCR family members
Overexpression studiesConstitutive or tissue-specific promoters driving PCR11 expressionAssess phenotypes under cadmium stress conditions; quantify cadmium accumulation
Promoter analysisPCR11 promoter:reporter gene fusionsIdentify regulatory elements responsible for sperm cell-specific expression
Localization studiesPCR11:GFP fusion proteinsDetermine subcellular localization to understand functional context

For cadmium stress experiments, researchers should expose plants to various concentrations of cadmium (typically 1-100 μM CdCl₂) and analyze multiple parameters including root length, shoot biomass, chlorophyll content, and cadmium accumulation in different tissues. Additionally, Advanced Intercross Recombinant Inbred Lines (AI-RILs) can be valuable for mapping quantitative trait loci (QTLs) associated with PCR11-dependent cadmium resistance traits .

What is known about the regulatory network controlling PCR11 expression under cadmium stress?

The regulation of PCR11 involves the DUO1 transcription factor, which specifically activates PCR11 in sperm cells . Experimental data shows that upon DUO1 induction, PCR11 is significantly upregulated, with log2-fold changes of 0.26, 2.21, and 4.03 at 6, 12, and 24 hours post-induction, respectively .

  • Metal-responsive transcription factors that bind to metal-responsive elements in the PCR11 promoter

  • Epigenetic modifications that regulate chromatin accessibility at the PCR11 locus

  • Post-transcriptional regulation via microRNAs or RNA-binding proteins

  • Post-translational modifications that affect PCR11 protein stability or activity

Further studies using chromatin immunoprecipitation (ChIP), DNA footprinting, and reporter gene assays would be necessary to comprehensively map the regulatory elements controlling PCR11 expression under cadmium stress.

How can evolutionary analysis of PCR11 inform our understanding of retrogene functionalization?

PCR11 represents an excellent model for studying retrogene functionalization in plants. Approximately 1% of Arabidopsis protein-coding genes are retrogenes, and PCR11 provides insights into how these genes acquire novel functions . The evolutionary analysis of PCR11 should consider:

  • Sequence comparison between PCR11 and its parent gene PCR2 to identify adaptive mutations

  • Analysis of selection pressure on different domains of the PCR11 protein

  • Comparative genomics across related species to determine the timing of the retrotransposition event

  • Examination of expression pattern differences between PCR11 and PCR2 across tissues and conditions

Such analyses would help understand the molecular mechanisms by which retrogenes like PCR11 escape silencing and acquire new functions. The DUO1-dependent activation of PCR11 in sperm cells, coupled with the downregulation of its parent gene PCR2, suggests an evolutionary scenario where the retrogene has taken over specialized functions in reproductive tissues .

What methodological approaches are recommended for resolving contradictory data in PCR11 functional studies?

When facing contradictory data in PCR11 functional studies, researchers should implement a systematic approach to resolve discrepancies:

Source of ContradictionResolution StrategyImplementation Details
Expression level discrepanciesMultiple detection methodsCombine qRT-PCR, RNA-seq, and protein-level detection (Western blot, mass spectrometry)
Phenotypic variationsControlled genetic backgroundsUse multiple knockout/overexpression lines in identical genetic backgrounds
Functional differences in cadmium responseStandardized stress conditionsApply identical cadmium concentrations, exposure times, and growth conditions across experiments
Variability in protein localizationMulti-tagged protein constructsCompare localization patterns using different tags (GFP, RFP, HA, etc.)
Contradictory protein-protein interactionsOrthogonal interaction assaysCombine yeast two-hybrid, co-immunoprecipitation, and bimolecular fluorescence complementation

Additionally, biological replication (using distinct biological samples) and technical replication (repeated measurements of the same sample) are essential for establishing statistical validity . When analyzing qRT-PCR data for PCR11, researchers should ensure that primer-pair specific efficiency is consistent, as this typically introduces relatively small errors (±20%) to state comparisons .

How can advanced genomic approaches be applied to study the functional genomic landscape of PCR11?

Advanced genomic approaches can provide comprehensive insights into the functional genomic landscape of PCR11:

  • CRISPR-Cas9 genome editing: Generate precise mutations in specific domains of PCR11 to assess their functional importance. This approach allows for targeted modifications without disrupting the entire gene.

  • ChIP-seq analysis: Identify genome-wide binding sites of transcription factors that regulate PCR11, particularly DUO1, which has been shown to activate PCR11 expression in sperm cells .

  • Single-cell RNA-seq: Profile PCR11 expression at the single-cell level, especially in reproductive tissues, to capture cell type-specific expression patterns that might be missed in bulk tissue analyses.

  • Quantitative Trait Locus (QTL) mapping: Utilize Advanced Intercross Recombinant Inbred Lines (AI-RILs) to map genetic loci controlling cadmium resistance traits associated with PCR11 function . The AI-RIL populations provide increased map resolution due to additional recombination events, allowing for more precise localization of QTLs.

  • Proteomics approaches: Identify PCR11 protein interactors and post-translational modifications that might regulate its function in cadmium resistance.

When designing these experiments, researchers should consider the unique characteristics of PCR11 as a retrogene with specialized expression patterns. For QTL mapping studies, the EstC and KendC AI-RIL populations, which have been genotyped with over 180 markers, provide excellent resources for analyzing complex traits related to PCR11 function .

What are the critical quality control measures for PCR11 expression analysis?

When analyzing PCR11 expression, several quality control measures are essential:

  • Primer specificity validation: Due to the similarity between PCR11 and its parent gene PCR2, primers must be carefully designed to specifically amplify PCR11. This can be verified through melt curve analysis, sequencing of PCR products, and testing on negative control samples lacking PCR11.

  • Reference gene selection: For accurate normalization of PCR11 expression data, appropriate reference genes must be selected. The stability of candidate reference genes should be validated under the specific experimental conditions being studied.

  • Standard curve validation: For absolute quantification, standard curves should demonstrate high efficiency (90-110%) and strong linearity (R² > 0.98). The kinetic curves for different RNA concentrations should be displaced by approximately 3.3 PCR cycles for 10-fold differences in template concentration .

  • No-template controls: Include controls without template to detect potential contamination or primer-dimer formation, which typically result in products forming only after 40 PCR cycles .

  • Biological replication: Multiple biological replicates (n ≥ 3) should be used to account for natural biological variation in PCR11 expression levels.

By implementing these quality control measures, researchers can ensure reliable and reproducible analysis of PCR11 expression patterns across different tissues, developmental stages, or stress conditions.

How can researchers effectively design experiments to study the interaction between PCR11 and other cadmium response genes?

To effectively study interactions between PCR11 and other cadmium response genes, researchers should design experiments that integrate multiple approaches:

  • Genetic interaction studies: Generate double/triple mutants combining PCR11 knockout with mutations in other cadmium response genes to identify synergistic, additive, or epistatic relationships.

  • Co-expression analysis: Perform transcriptome analyses to identify genes whose expression patterns correlate with PCR11 under cadmium stress conditions, potentially revealing functional associations.

  • Protein-protein interaction screens: Use yeast two-hybrid, split-ubiquitin, or co-immunoprecipitation approaches to identify proteins that physically interact with PCR11.

  • Subcellular co-localization studies: Conduct fluorescence microscopy with differentially labeled proteins to determine whether PCR11 co-localizes with other cadmium response proteins in the same cellular compartments.

  • Promoter analysis: Identify shared regulatory elements between PCR11 and other cadmium response genes that might indicate co-regulation under stress conditions.

When designing these experiments, it's important to consider that PCR11 has a specialized expression pattern in sperm cells, which may limit its direct interactions with some broadly expressed cadmium response genes. Therefore, tissue-specific analyses focusing on reproductive tissues may be particularly informative.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.