Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 1 (PCR1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PCR1; At1g14880; F10B6.29; Protein PLANT CADMIUM RESISTANCE 1; AtPCR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PCR1
Target Protein Sequence
MEAQLHAKPHAQGEWSTGFCDCFSDCRNCCITLCCPCITFGQVAEIVDRGSKSCCAAGAL
YMLIDLITSCGRMYACFYSGKMRAQYNIKGDGCTDCLKHFCCNLCALTQQYRELKHRGFD
MSLGWAGNAEKQQNQGGVAMGAPAFQGGMTR
Uniprot No.
Target Background
Function
PCR1 (PLANT CADMIUM RESISTANCE 1) is involved in glutathione-independent cadmium resistance in *Arabidopsis thaliana*. It reduces cadmium uptake rather than promoting efflux, and its function is not directly linked to calcium transporters.
Database Links
Protein Families
Cornifelin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in aerial part, but not in roots. Detected in the guard and mesophyll cells.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
