Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 4 (PCR4)

Shipped with Ice Packs
In Stock

Description

Production of Recombinant Proteins

Recombinant protein production involves several key steps:

  1. Gene Cloning The gene encoding the target protein (e.g., PCR4 from Arabidopsis thaliana) is isolated and amplified using PCR (polymerase chain reaction) .

  2. Vector Insertion The amplified gene is inserted into a plasmid vector, which is a circular DNA molecule used to carry foreign DNA into a host cell .

  3. Transformation The plasmid vector containing the gene is introduced into a host organism, such as Escherichia coli, for expression .

  4. Expression The host organism is cultured under conditions that promote gene expression, leading to the production of the recombinant protein . For example, the addition of isopropyl β-D-1-thiogalactopyranoside (IPTG) can induce protein expression .

  5. Purification The recombinant protein is isolated and purified from the host cells using various techniques, such as affinity chromatography .

Case Studies and Research Findings

While specific detailed research findings and data tables for Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 4 (PCR4) are not available in the provided references, research regarding recombinant proteins and Arabidopsis thaliana generally can offer insights.

2.1. Molecular Pharming of Recombinant Proteins

Arabidopsis thaliana is used in molecular pharming to produce recombinant proteins, indicating its utility in expressing foreign genes . For example, transgenic Arabidopsis plants have been engineered to express the AtOLE-hEGF–hEGF gene, and the recombinant protein was detected and quantified using RT-PCR and western blotting .

2.2. Haem-Binding Proteins

Proteomic analysis of haem-binding proteins from Arabidopsis thaliana involves the expression and purification of recombinant proteins . DNA fragments encoding candidate proteins are amplified using PCR and cloned into expression vectors. The resulting plasmids are introduced into Escherichia coli strains to express His-tagged fusion proteins, which are then purified for further characterization .

2.3. T-DNA Integration

Studies on T-DNA integration in Arabidopsis thaliana have utilized PCR to identify transgenic plants without selection bias . This approach helps to identify transformants with integrations into genomic regions that may suppress transcription, providing a more comprehensive understanding of T-DNA integration patterns .

2.4. Reference Genes for Expression Analysis

Reference genes in Arabidopsis thaliana are crucial for accurate qPCR expression analysis . Studies assessing the expression stability of candidate reference genes, such as UBC9, ACT7, and GAPC-2, provide valuable tools for gene expression studies in reproductive tissues .

2.5. Alternative Oxidase (AOX) Protein

Recombinant Arabidopsis thaliana AOX1A protein (rAtAOX1A) has been produced and characterized to study its interaction with inhibitors . The purified recombinant protein is analyzed using SDS-PAGE and MALDI-TOF/TOF to confirm its identity and structural properties .

Potential Applications

Although the specific functions and applications of PCR4 are not detailed in the provided documents, the general role of recombinant proteins and research on Arabidopsis thaliana suggest several potential applications:

  1. Bioremediation PCR4 may play a role in cadmium resistance, suggesting its potential use in bioremediation to remove heavy metals from contaminated soils .

  2. Crop Improvement Understanding the function of PCR4 could lead to the development of cadmium-resistant crops, enhancing food security in contaminated areas.

  3. Pharmaceutical Production Recombinant PCR4 or modified versions could be produced for pharmaceutical applications, if it possesses relevant therapeutic properties.

  4. Industrial Applications The protein might have enzymatic or binding properties that could be exploited in industrial processes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PCR4; At3g18460; MYF24.18; Protein PLANT CADMIUM RESISTANCE 4; AtPCR4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PCR4
Target Protein Sequence
MGRPGSQPNEAQPPPVQVQPTVNRDNQVHSQNGAIGQANIQTGRPVNNQTQNLWSSDLFD CMNDSENAVITCLAPCVTLGQIAEIVDEGATPCATGGLLYGMIFFIGVPFVYSCMFRAKM RNKYGLPDAPAPDWITHLFCEHCALCQEYRELKHRGFDPNIGWAGNVQAQQPVMSPPTGQ RMMG
Uniprot No.

Target Background

Function
Potentially involved in heavy metal transport.
Database Links

KEGG: ath:AT3G18460

STRING: 3702.AT3G18460.1

UniGene: At.53371

Protein Families
Cornifelin family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structural characterization of PCR4 and how does it compare to other cadmium resistance proteins?

PCR4 belongs to a family of plant proteins involved in heavy metal resistance. While specific structural data on PCR4 is still emerging, research on related proteins such as WAKL4 (Wall-Associated Kinase-Like 4) provides valuable comparative insights. WAKL4 is a cell wall-associated receptor-like kinase that plays a crucial role in cadmium tolerance in Arabidopsis thaliana .

Similar to how WAKL4 functions as a receptor-like kinase with an extracellular domain that potentially senses cadmium, PCR4 likely contains specific binding domains that interact with cadmium ions. The structural analysis should focus on identifying conserved metal-binding motifs, particularly cysteine-rich regions that commonly coordinate heavy metals in resistance proteins.

What is the tissue-specific expression pattern of PCR4 in Arabidopsis thaliana?

Tissue-specific expression analysis is essential for understanding PCR4 function. Drawing parallels with WAKL4, which shows predominant expression in roots (similar to NRAMP1) , PCR4 expression patterns likely vary across different plant tissues and developmental stages.

For comprehensive expression analysis, researchers should employ:

  • qRT-PCR analysis of different tissues (roots, shoots, leaves, flowers)

  • Promoter-reporter fusion constructs (PCR4pro:GUS) to visualize expression patterns

  • RNA-seq data analysis across different tissues and developmental stages

  • Immunolocalization using PCR4-specific antibodies

How is PCR4 transcriptionally regulated under cadmium stress conditions?

Cadmium stress specifically upregulates certain defense mechanisms in plants. For instance, WAKL4 protein abundance rapidly accumulates within 1 hour after cadmium treatment, peaking shortly thereafter . This regulation occurs through both increased transcription and reduced proteolysis.

When investigating PCR4 transcriptional regulation, researchers should:

  • Perform time-course experiments exposing plants to cadmium and measuring PCR4 transcript levels

  • Analyze PCR4 promoter regions for metal-responsive elements

  • Identify transcription factors that bind to the PCR4 promoter under cadmium stress

  • Compare regulation under different metal stresses to determine specificity (similar to how WAKL4 responds specifically to cadmium but not other metal elements)

What protein interactions does PCR4 form to mediate cadmium resistance?

Protein interaction networks are critical for understanding functional mechanisms. The WAKL4-NRAMP1 interaction represents an important model for cadmium resistance mechanisms in Arabidopsis. WAKL4 interacts with and phosphorylates the cadmium transporter NRAMP1 at Tyr488, leading to enhanced ubiquitination and vacuole-dependent degradation of NRAMP1, consequently reducing cadmium uptake .

To investigate PCR4 protein interactions:

  • Perform yeast two-hybrid (Y2H) screening to identify potential interacting partners

  • Validate interactions using bimolecular fluorescence complementation (BiFC) assays

  • Conduct co-immunoprecipitation (Co-IP) experiments with tagged PCR4

  • Use split-luciferase complementation assays as demonstrated with WAKL4-NRAMP1

  • Analyze post-translational modifications that may regulate these interactions

How can CRISPR-Cas9 technology be utilized to study PCR4 function?

CRISPR-Cas9 provides powerful tools for functional genomics in Arabidopsis research. The technology has been successfully employed in Arabidopsis using both Streptococcus pyogenes Cas9 and Staphylococcus aureus Cas9 .

For PCR4 functional studies using CRISPR-Cas9:

  • Design specific guide RNAs targeting PCR4 coding sequences

  • Utilize egg cell-specific promoters (EC1.1/EC1.2) for efficient editing, as demonstrated in the heterochromatic knob reversal experiments

  • Generate knockout, knockdown, and specific domain mutations to study structure-function relationships

  • Create tagged versions for protein localization and interaction studies

  • Use base editing to introduce specific amino acid changes at potential metal-binding sites

Table 1: Comparison of CRISPR-Cas9 systems for editing PCR4 in Arabidopsis

ParameterSpCas9SaCas9
PAM sequenceNGGNNGRRT
Protein size1,368 aa1,053 aa
Vector capacityLowerHigher
Editing efficiency in ArabidopsisGoodVery good
Recommended promoterEC1.1/EC1.2EC1.1/EC1.2
Off-target effectsModerateLower

What is the molecular mechanism of PCR4-mediated cadmium detoxification?

Understanding detoxification mechanisms is crucial for characterizing metal resistance proteins. Based on known cadmium tolerance mechanisms, several potential pathways could be involved:

  • Reduced uptake: Like the WAKL4-NRAMP1 module that restricts cadmium uptake through transporter regulation

  • Vacuolar sequestration: Similar to HMA3-mediated vacuolar sequestration in certain Arabidopsis ecotypes

  • Chelation mechanisms: Through phytochelatin or metallothionein production

  • Efflux mechanisms: Via plasma membrane transporters

To investigate PCR4's mechanism:

  • Compare cadmium content in wild-type vs. pcr4 mutant plants

  • Analyze subcellular localization of cadmium using fluorescent indicators

  • Measure expression of known cadmium response genes in pcr4 mutants

  • Perform metabolomic analysis to identify potential chelating compounds

How does PCR4 function compare across different Arabidopsis ecotypes?

Genetic variation between ecotypes can significantly impact metal tolerance mechanisms. For example, HMA3 is functional in the Wassilewskija (Ws) ecotype but nonfunctional in Columbia-0 (Col-0) due to an SNP causing premature termination . This partly explains why Col-0 is more sensitive to cadmium than Ws.

For PCR4 ecotype comparison studies:

  • Sequence PCR4 across diverse Arabidopsis ecotypes to identify polymorphisms

  • Compare expression patterns and protein levels in different ecotypes

  • Test cadmium sensitivity in various ecotypes and correlate with PCR4 sequence/expression

  • Perform complementation studies by expressing PCR4 variants in sensitive backgrounds

What are the optimal methods for expressing and purifying recombinant PCR4?

Recombinant protein production is essential for biochemical characterization. Based on successful approaches with other Arabidopsis proteins:

  • Expression system selection:

    • E. coli: Suitable for producing untagged recombinant proteins as demonstrated with NFU1

    • Yeast: Better for proteins requiring eukaryotic post-translational modifications

    • Plant-based expression: Consider when native folding is critical

  • Purification strategy:

    • Design constructs with appropriate affinity tags (His, GST, FLAG)

    • Optimize solubility through fusion partners or modified buffer conditions

    • Consider native vs. denaturing conditions based on protein characteristics

  • Activity preservation:

    • Include metal chelators if necessary to prevent oxidation of cysteine residues

    • Optimize buffer composition to maintain protein stability

    • Consider adding reducing agents if the protein contains reactive cysteines

How can researchers accurately measure PCR4-cadmium binding properties?

Characterizing metal-protein interactions requires specialized techniques:

  • Isothermal Titration Calorimetry (ITC):

    • Provides binding constants (Kd), stoichiometry, and thermodynamic parameters

    • Requires purified protein in solution

    • Can distinguish between binding sites with different affinities

  • Microscale Thermophoresis (MST):

    • Measures binding in solution with minimal protein consumption

    • Suitable for detecting conformational changes upon cadmium binding

  • Spectroscopic methods:

    • UV-Vis spectroscopy to detect ligand-metal charge transfer

    • Circular dichroism to monitor structural changes upon cadmium binding

    • Fluorescence spectroscopy if tryptophan residues are near binding sites

Table 2: Metal-binding analysis techniques comparison

TechniqueProtein requirementSensitivityParameters measuredLimitations
ITC0.5-5 mgHighKd, ΔH, ΔS, nHigh protein consumption
MST0.1-0.5 mgVery highKdRequires fluorescent labeling
UV-Vis0.2-1 mgModerateBinding eventsLimited quantitative data
CD0.2-1 mgModerateStructural changesIndirect binding measurement
ICP-MS0.1-0.5 mgExtremely highMetal contentDestructive analysis

What is the most effective approach for generating and phenotyping PCR4 transgenic lines?

Creating well-characterized transgenic lines is fundamental for functional studies:

  • Generation strategies:

    • CRISPR-Cas9 for knockout/knockin using egg cell-specific promoters

    • Overexpression using constitutive (35S) or tissue-specific promoters

    • Complementation with native promoter as demonstrated for WAKL4

  • Selection of appropriate backgrounds:

    • Columbia-0 (Col-0) shows increased sensitivity to cadmium compared to Wassilewskija (Ws)

    • Consider ecotype-specific differences in cadmium tolerance mechanisms

  • Phenotyping approaches:

    • Root length measurement under varying cadmium concentrations

    • Biomass and chlorophyll content assessment as performed for WAKL4 studies

    • Cadmium content analysis using ICP-MS

    • Visualization of reactive oxygen species and membrane integrity

  • Experimental design considerations:

    • Include multiple independent transgenic lines (minimum 3)

    • Test various cadmium concentrations to establish dose-response curves

    • Examine responses in both hydroponic and soil-based systems

    • Analyze multiple developmental stages

How does PCR4 function compare with other known cadmium response mechanisms in Arabidopsis?

Arabidopsis possesses several mechanisms for cadmium tolerance, including:

  • WAKL4-NRAMP1 module: Limits cadmium uptake by triggering NRAMP1 degradation

  • HMA3: Enables vacuolar sequestration of cadmium (functional in Ws but not Col-0)

  • Phytochelatin synthesis: Chelates cadmium for detoxification

  • Antioxidant systems: Mitigates cadmium-induced oxidative stress

Comparative analysis approaches:

  • Generate double mutants (pcr4 with other pathway components)

  • Compare transcriptome profiles between different mutant lines

  • Analyze cadmium distribution patterns in various mutant backgrounds

  • Test epistatic relationships through genetic analysis

What role does PCR4 play in Arabidopsis reproduction and development under cadmium stress?

Cadmium stress affects multiple developmental processes in plants. Interestingly, plastid functions appear important for female gametogenesis as demonstrated in CLB19 studies . Additionally, truncated protein expression can interfere with cell fate during megasporogenesis .

To investigate PCR4's developmental roles:

  • Analyze reproductive tissue development in pcr4 mutants under cadmium stress

  • Compare pollen viability and seed set in control vs. cadmium-stressed conditions

  • Examine embryo and seedling development following cadmium exposure

  • Investigate potential roles in plastid function during reproductive development

How can PCR4 knowledge contribute to developing crops with reduced cadmium accumulation?

Translational applications of PCR4 research include:

  • Crop improvement strategies:

    • Identify PCR4 orthologs in crop species for targeted modification

    • Utilize CRISPR-Cas9 to enhance native PCR4 function in crops

    • Develop specific markers for breeding programs

  • Biofortification approaches:

    • Combine PCR4 enhancement with other cadmium exclusion mechanisms

    • Balance cadmium exclusion with essential micronutrient uptake

    • Consider tissue-specific expression to minimize cadmium in edible portions

  • Phytoremediation applications:

    • Evaluate PCR4 overexpression for enhanced cadmium accumulation in non-food crops

    • Design hyperaccumulator plants with modified PCR4 expression

The WAKL4-NRAMP1 module's ability to limit cadmium uptake provides a model for how PCR4 manipulation could inform molecular breeding approaches for developing crops with reduced cadmium accumulation .

What techniques are most promising for high-throughput screening of PCR4 variants?

For accelerated PCR4 research:

  • DNA synthesis and assembly:

    • Create libraries of PCR4 variants with systematic mutations

    • Utilize Golden Gate assembly for modular cloning of variant libraries

  • Screening platforms:

    • Yeast-based functional complementation assays

    • Plant protoplast transient expression systems

    • CRISPR base editing arrays for in planta variant screening

  • Selection methods:

    • Cadmium resistance as a direct selection marker

    • Fluorescent reporters linked to cadmium-responsive promoters

    • High-content imaging of seedling development under cadmium stress

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.