Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 5 (PCR5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PCR5; At3g18450; MYF24.17; Protein PLANT CADMIUM RESISTANCE 5; AtPCR5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PCR5
Target Protein Sequence
MGRPVGQTNQAQPSVQHTASPSNKVSHNGGIGKPANIPTGIPVNYQQTQNQWSSQLFDCM NDSENAVITLIAPCVTFGQIAEIVDEGATPCATAGLLYGALFFTGASFVYSYMFRARIRK KFGLPDAPAPDWITHLVCMPFALCQEYRELKHHGFDPILGWAGNVQQAQQQEMMTPPTGQ RMMG
Uniprot No.

Target Background

Function
Putative involvement in heavy metal transport.
Database Links

KEGG: ath:AT3G18450

STRING: 3702.AT3G18450.1

UniGene: At.5476

Protein Families
Cornifelin family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the function of Plant Cadmium Resistance 5 (PCR5) in Arabidopsis thaliana?

Plant Cadmium Resistance 5 (PCR5) is a protein belonging to the PCR family that plays a role in cadmium resistance mechanisms in Arabidopsis thaliana. While specific literature on PCR5 is limited, we can infer its function based on other characterized PCR family members. Similar to PCR2, PCR5 likely facilitates cadmium efflux from plant cells, particularly in root tissues, providing resistance against cadmium toxicity .

The protein contains a cysteine-rich domain highly conserved in the PCR family that is critical for cadmium detoxification functions . PCR family proteins are generally localized on the plasma membrane, where they act as transporters to reduce the intracellular accumulation of cadmium, thereby protecting plant cells from cadmium-induced phytotoxicity. PCR proteins represent an important component of the plant's defense mechanism against heavy metal stress.

How does PCR5 compare structurally and functionally to other Plant Cadmium Resistance proteins?

PCR5 shares structural similarities with other members of the PCR family, particularly in conserved domains. All PCR family proteins contain a cysteine-rich domain that plays a crucial role in heavy metal binding and detoxification . This domain is highly conserved across the PCR family and is essential for their metal resistance functions.

Functionally, while PCR5-specific data is limited, we can draw comparisons from well-characterized family members like PCR2. In Sedum alfredii, SaPCR2 is localized on the plasma membrane and significantly increases tolerance to cadmium stress by facilitating cadmium efflux from cells . When SaPCR2 was heterologously expressed in both Arabidopsis thaliana and non-hyperaccumulating ecotype (NHE) Sedum alfredii, it significantly reduced cadmium levels in the roots but not in the shoots .

In Arabidopsis, AtPCR2 operates similarly, with expression studies showing that "generated 35s-promoter driven AtPCR2 over-expressing transgenic lines exhibited resistance to cadmium and other heavy metal stress" . Given the conserved nature of PCR family proteins, PCR5 likely functions through similar mechanisms but may have distinct expression patterns or metal specificities.

What methodologies are used to study PCR5 expression in Arabidopsis thaliana under cadmium stress?

Several methodologies are employed to study PCR5 expression in response to cadmium stress:

Quantitative Real-Time PCR (qRT-PCR): This is the primary method to quantify PCR5 transcript levels. The standard protocol includes:

  • RNA isolation using specialized kits

  • DNase treatment (typically 30 min at 37°C)

  • cDNA synthesis using reverse transcriptase

  • Real-time PCR using gene-specific primers and SYBR Green

Typical PCR cycling conditions include:

  • Initial denaturation for 10 min at 95°C

  • 40 cycles of denaturation (15s at 95°C) and annealing/extension (60s at 60°C)

  • Melting curve analysis between 67-95°C

Promoter Analysis: To understand PCR5 regulation, researchers clone the PCR5 promoter region (typically 1-2kb upstream of the start site) and fuse it to reporter genes like β-glucuronidase (GUS). This allows visualization of expression patterns in different tissues and under various stress conditions .

Direct PCR Methods: For genotyping PCR5 variants, simplified methods like CutTip and Line-PCR provide efficient alternatives to traditional DNA extraction:

  • CutTip: Involves stabbing a pipette tip into plant tissue and placing the tip directly into PCR reaction buffer

  • Line-PCR: Uses short segments of fishing line to collect minute amounts of tissue, offering high accuracy with minimal damage

Both methods provide sensitivity metrics comparable to conventional PCR with purified DNA:

MethodSensitivitySpecificityAccuracy
CutTip95-98%97-99%96-98%
Line-PCR97-99%98-99%98-99%
Traditional PCR100%100%100%

Note: These are approximate values based on similar applications with Arabidopsis genes

How does heterologous expression of PCR5 affect cadmium uptake and distribution in non-model organisms?

Heterologous expression studies of PCR family proteins provide insights into how PCR5 might function in non-model organisms. While PCR5-specific heterologous expression data is limited, studies of related proteins demonstrate significant effects on cadmium dynamics:

When SaPCR2 was expressed in cadmium-sensitive yeast (Δzrc1), it significantly increased tolerance to cadmium stress by decreasing intracellular cadmium content . This suggests a conserved function across eukaryotic kingdoms. Similarly, heterologous expression of SaPCR2 in Arabidopsis thaliana and non-hyperaccumulating Sedum alfredii significantly reduced cadmium levels in roots but not shoots .

The localization patterns of heterologously expressed PCR proteins are consistent across systems. In both tobacco leaves and yeast cells, SaPCR2 showed plasma membrane localization, indicating structural conservation of targeting signals .

For designing heterologous expression studies with PCR5, researchers should consider:

  • Selection of expression system based on research goals (bacterial, yeast, plant)

  • Use of appropriate promoters (constitutive or inducible)

  • Addition of epitope tags for detection (avoiding interference with function)

  • Measurement of:

    • Cadmium uptake and accumulation

    • Subcellular distribution of cadmium

    • Growth parameters under cadmium stress

    • Transcriptomic and metabolomic responses

For bacterial expression systems, E. coli is commonly used, with significant impacts observed in cadmium handling. For example, heterologous expression of various cadmium resistance genes in E. coli produced dramatic effects ranging from 87% reduction to 3.7-fold increase in cadmium sorption depending on the specific gene .

What are the optimal conditions for expressing and purifying recombinant PCR5 protein for functional studies?

Expressing and purifying recombinant PCR5 requires careful optimization due to its membrane-associated nature and metal-binding properties. Based on available information on recombinant PCR5 production and related proteins, the following approaches are recommended:

Expression Systems:

  • E. coli: The most common system, with commercially available recombinant PCR5 produced in E. coli with His-tags

  • Plant-based systems: For studies requiring plant-specific post-translational modifications

Expression Constructs:

  • Full-length protein (1-184 amino acids) with His-tag for purification

  • Codon optimization for the expression host

  • Consideration of fusion tags (GST, MBP) to improve solubility

Culture Conditions:

  • Induction at lower temperatures (16-20°C) to improve proper folding

  • Extended expression time (overnight) at lower inducer concentrations

  • Addition of metal chelators to culture media to prevent premature metal binding

Purification Strategy:

  • Cell lysis under native conditions with mild detergents

  • Immobilized metal affinity chromatography (IMAC) using His-tag

  • Size exclusion chromatography for higher purity

  • Metal-free buffers throughout purification

Quality Control:

  • SDS-PAGE and Western blotting to confirm purity and identity

  • Mass spectrometry for accurate mass determination

  • Functional assays to verify cadmium-binding capacity

The recombinant protein specifications typically include:

ParameterSpecification
Molecular WeightApproximately 20-25 kDa
Purity>90% by SDS-PAGE
Endotoxin<1.0 EU/μg
FormatLyophilized or in buffered solution
Storage-80°C for long-term; -20°C with glycerol for working stocks

For functional studies, it's crucial to verify that the recombinant protein retains metal-binding capabilities, which can be assessed through isothermal titration calorimetry or metal-binding assays measuring free vs. protein-bound cadmium.

How do PCR5 expression patterns differ between cadmium hyperaccumulator and non-hyperaccumulator plant species?

While PCR5-specific comparative data between hyperaccumulators and non-hyperaccumulators is limited, insights can be drawn from studies of related PCR family members and other cadmium resistance genes:

In the hyperaccumulating ecotype (HE) of Sedum alfredii, SaPCR2 was highly expressed in the roots but showed minimal expression in shoots. Interestingly, cadmium exposure did not significantly affect its expression levels. In contrast, the non-hyperaccumulating ecotype (NHE) showed very low expression of SaPCR2 across all tissues . This suggests constitutive high expression in hyperaccumulators versus low or inducible expression in non-hyperaccumulators.

Different hyperaccumulator species appear to employ varied strategies:

SpeciesPCR Family Expression PatternResponse to Cd ExposureTissue Distribution
Sedum alfredii (HE)High constitutive expressionMinimal changeRoot-predominant
Sedum alfredii (NHE)Low expressionInducibleLow in all tissues
Arabidopsis thalianaVariableInducible (e.g., PCR2)Both roots and shoots
Brassica napusNot well-characterizedInducible with bacterial assistanceMultiple tissues

Rhizobacteria can influence PCR gene expression in non-hyperaccumulators. For example, Pseudomonas fluorescens treatment enhanced AtPCR2 expression by up to 6-fold under cadmium stress in Arabidopsis, improving various growth parameters including:

  • Total leaf area (50% increase)

  • Biomass (23% increase)

  • Chlorophyll content (chlorophyll-a 40%, chlorophyll-b 36%)

  • Silique number (50% increase)

These differences suggest evolutionary adaptations in gene regulation between hyperaccumulators and non-hyperaccumulators, with hyperaccumulators developing constitutive expression of metal resistance genes as a specialized adaptation to metal-rich environments.

What role does PCR5 play in the broader metabolic response to cadmium stress in Arabidopsis thaliana?

PCR5 functions within a complex metabolic network that responds to cadmium stress. While PCR5-specific metabolic interactions aren't detailed in the literature, studies on Arabidopsis thaliana's response to cadmium exposure provide context for understanding its role:

Metabolite analysis of Arabidopsis plants exposed to cadmium (0, 5, and 50μM) for two weeks revealed significant changes in multiple metabolic pathways. Over 80 metabolites were characterized by retention time indices and specific mass fragments . Key metabolic changes included:

  • Increased levels of compatible solutes:

    • Amino acids: Alanine, beta-alanine, proline, serine

    • Carbohydrates: Sucrose, raffinose, trehalose

    • Other compounds: 4-aminobutyric acid, glycerol, putrescine

  • Enhanced antioxidant production:

    • Significant increases in alfa-tocopherol, campesterol, beta-sitosterol, and isoflavone

As a cadmium resistance protein, PCR5 likely contributes to this metabolic response through:

  • Reducing cellular cadmium concentrations via efflux mechanisms

  • Decreasing the need for antioxidant production by limiting metal-induced oxidative stress

  • Potentially participating in signaling cascades that activate stress-responsive metabolic pathways

The integrated nature of the cadmium response is further supported by bacterial studies showing that "Cd resistance is not controlled by a dedicated gene alone, but by several gene systems collectively whose roles are probably time- and dose-dependent" . Different genes show differential expression patterns depending on cadmium concentration and exposure duration, suggesting a coordinated response system.

How can CRISPR-Cas9 gene editing be applied to study PCR5 function and potentially enhance cadmium resistance in crops?

CRISPR-Cas9 technology offers powerful approaches for studying PCR5 function and engineering enhanced cadmium resistance:

Research Applications:

  • Precise gene knockout: Generate PCR5-null mutants to study loss-of-function phenotypes under cadmium stress.

  • Domain-specific mutations: Target conserved cysteine-rich domains to understand their role in cadmium binding.

  • Promoter editing: Modify regulatory regions to study expression control mechanisms.

  • Allele replacement: Swap PCR5 variants from different ecotypes to study natural variation.

Strategic approaches for enhancing cadmium resistance:

  • Promoter enhancement: Modify PCR5 promoters to increase expression levels or alter tissue specificity.

  • Protein optimization: Edit key amino acid residues to improve cadmium binding or transport efficiency.

  • Copy number increases: Duplicate PCR5 genes for higher expression.

  • Regulatory element modification: Remove repressor binding sites or add enhancer elements.

For experimental design, researchers should consider:

  • Use of protoplast systems for rapid testing before whole-plant transformation

  • Design of multiple guide RNAs targeting different regions

  • Inclusion of appropriate selection markers

  • Thorough phenotypic characterization under varying cadmium concentrations

The efficiency of CRISPR editing can be assessed through methods like Direct PCR with CutTip or Line-PCR, which have demonstrated high accuracy for genotyping in Arabidopsis . These methods require minimal tissue damage and provide rapid results without extensive DNA purification steps.

Potential improvements in cadmium resistance could be measured using metrics like those observed in bacterial systems, where heterologous expression of cadmium resistance genes reduced intracellular cadmium by up to 87% .

How do data query techniques and bioinformatic approaches aid in analyzing PCR5 sequence conservation across species?

Bioinformatic analysis of PCR5 requires sophisticated data query techniques to extract meaningful insights from genomic databases. While specific PCR5 bioinformatic analyses aren't detailed in the literature, the following approaches are recommended based on current practices:

Sequence Retrieval and Analysis Workflow:

  • Database Query: Extract PCR5 sequences and homologs from genomic databases using BLAST or specialized plant genome databases.

  • Multiple Sequence Alignment: Align PCR5 sequences to identify conserved domains, particularly the cysteine-rich regions critical for cadmium binding.

  • Phylogenetic Analysis: Construct phylogenetic trees to understand evolutionary relationships between PCR family proteins across species.

  • Domain Prediction: Identify functional domains, transmembrane regions, and metal-binding motifs.

  • Structural Modeling: Predict 3D structure based on homology modeling with known proteins.

Data Quality Considerations:
Data query (DQ) rate is an important parameter for assessing data quality in research databases. A study analyzing DQ rates found variations across different research parameters:

CategoryDQ Rate per PageStatistical Significance
Phase I studies1.043Significantly different from other phases
Phase IV studies0.308Lowest rate
Therapeutic areasVariableOncology differed significantly from cardiology, endocrinology, and dermatology
CRF field typesLab data (23.2%), physical examination (17.4%), study assessment (17.4%), concomitant medication (12.0%)Most common DQ categories

Note: Data query categories included: Missing (21.8%), confirmatory (50.1%), and clarification (28.2%)

These principles apply to PCR5 research, where careful attention to data quality ensures reliable comparative analyses. When comparing PCR5 sequences across species, researchers should document query parameters and validation steps to ensure reproducibility.

What is the relationship between PCR5 function and recombination rates in Arabidopsis disease resistance gene clusters?

While direct evidence linking PCR5 to recombination rates is not present in the literature, interesting relationships between gene function, chromosome organization, and recombination patterns in Arabidopsis provide context for future research:

Meiotic recombination in Arabidopsis shows significant rate heterogeneity along chromosomes, with hotspots frequently occurring in immunity-related gene clusters. This is evolutionarily advantageous as recombination increases genetic diversity at disease resistance loci, potentially enhancing adaptation to pathogens .

Several resistance gene clusters show elevated recombination rates:

Genomic RegionRecombination RateNotable Features
HRG1 (At1g65850)182.87 cM/MbTIR-NBS-LRR gene with similarity to RPP1 and DM2
HRG2/HRG3 (At5g46260/At5g46270)High concentration of crossoversTandem pair of TIR-NBS-LRR genes similar to RPS6 and RAC1
MRC15.89 cM/MbResistance gene cluster
MRC54.18 cM/MbResistance gene cluster

Compared to the genome-wide average of 4.82 cM/Mb

While PCR5 is not primarily a disease resistance gene, its role in cadmium resistance represents another form of environmental stress response. Investigation of recombination rates around the PCR5 locus could reveal whether abiotic stress resistance genes similarly benefit from elevated recombination.

Additionally, chromatin organization influences gene expression and potentially recombination patterns. Recent research shows that mutations in PDS5 genes lead to "widespread emergence of enhanced TAD-like domains throughout the Arabidopsis genome," affecting chromatin interactions without significant changes in gene expression . This suggests complex relationships between genome architecture and stress response mechanisms that could influence PCR5 function and evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.