Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 6 (PCR6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
PCR6; At1g49030; F27J15.18; Protein PLANT CADMIUM RESISTANCE 6; AtPCR6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PCR6
Target Protein Sequence
MGRPDQTPSPRMNNNFNPVFHAQSEQPVDEKRVLQAEQIYPNNGGVVNQPNQVPMRPGPP TYINQSATFNQPYGVSMAGPVHTQPSNWTSGLFDCMNDGENALITCCFPFVTFGQIAEVI DEGATSCGTAGMLYGLICCLFAIPCVYTCTFRTKLRSKYGLPDAPAPDWITHCFCEYCAL CQEYRELKNRGLDPSIGWIGNVQKQRMGQQQEMMAPPMGQRMMG
Uniprot No.

Target Background

Function

Potentially involved in heavy metal transport.

Database Links

KEGG: ath:AT1G49030

STRING: 3702.AT1G49030.1

UniGene: At.70215

Protein Families
Cornifelin family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the function of PCR6 in Arabidopsis thaliana?

PCR6 (Plant Cadmium Resistance 6) is a protein involved in heavy metal tolerance mechanisms in Arabidopsis thaliana. PCR6 belongs to the PCR family of proteins that play crucial roles in conferring resistance to cadmium toxicity . The protein is encoded by the At1g49030 gene (also identified as F27J15.18) .

Research indicates that cadmium-related transporters, including PCR6, are significantly upregulated under cadmium stress conditions . While PCR2 has been more extensively studied, PCR6 shows similar functional patterns in mediating cadmium tolerance through membrane transport mechanisms.

Methodology for determining function:

  • Gene expression analysis under varying cadmium concentrations

  • Phenotypic assessment of wild-type vs. PCR6 knockout/overexpression lines

  • Subcellular localization studies to determine protein activity sites

How does PCR6 expression change under cadmium stress conditions?

Transcriptomic analyses have revealed that PCR6 expression is significantly upregulated in response to cadmium exposure. Studies have shown:

  • PCR6 transcript levels increase by approximately 5-6 fold under cadmium stress conditions

  • Upregulation occurs in coordination with other cadmium-related transporters

  • Expression patterns are tissue-specific, with stronger responses observed in root tissues compared to shoots

Research methodology typically involves:

  • Exposing Arabidopsis plants to varying concentrations of cadmium (typically 5-20 μM CdCl₂)

  • Harvesting tissues at different time points (3h, 6h, 12h, 24h)

  • Performing qRT-PCR analysis with PCR6-specific primers

  • Normalizing expression data against housekeeping genes like actin

What are the key experimental techniques for studying PCR6 function?

Several complementary techniques are essential for comprehensive functional analysis of PCR6:

TechniqueApplicationExpected Outcome
qRT-PCRGene expression analysisQuantification of PCR6 transcript levels under various conditions
Western blotProtein detectionVerification of PCR6 protein expression and accumulation
GFP fusion constructsSubcellular localizationDetermination of PCR6 localization within plant cells
Yeast complementationFunctional validationAssessment of PCR6 ability to rescue cadmium-sensitive yeast mutants
CRISPR-Cas9 gene editingLoss-of-function studiesCreation of PCR6 knockout lines for phenotypic analysis
Overexpression linesGain-of-function studiesAssessment of enhanced cadmium tolerance in PCR6-overexpressing plants

These techniques should be applied systematically to build a comprehensive understanding of PCR6 function in cadmium stress responses.

What is the relationship between PCR6 and other cadmium tolerance mechanisms in plants?

PCR6 functions within a broader network of cadmium tolerance mechanisms in Arabidopsis:

  • PCR6 works in parallel with other PCR family members, particularly PCR2, which has been more extensively characterized

  • Transcriptomic studies reveal coordination with other cadmium-related transporters including metal transporter (Nramp1), metal tolerance proteins (MTPC2 and MTP11), and cadmium transporter ATPases

  • PCR6 functions appear to be part of the plant's cadmium detoxification strategy, likely involving sequestration or efflux mechanisms

The interplay between these various mechanisms creates a robust defense system against cadmium toxicity. Research typically examines multiple genes simultaneously to understand the coordinated response.

What molecular mechanisms underlie PCR6-mediated cadmium resistance?

Recent studies suggest several potential mechanisms for PCR6-mediated cadmium resistance:

  • Membrane transport regulation: PCR6 likely functions as a transmembrane transporter that regulates cadmium movement across cellular compartments or between tissues.

  • Subcellular sequestration: Evidence indicates PCR6 may facilitate cadmium compartmentalization into vacuoles, reducing cytoplasmic toxicity. This is supported by studies showing increased vacuolar cadmium in plants with elevated PCR expression .

  • Signaling pathway integration: PCR6 may interact with stress signaling pathways, possibly including ABA-dependent mechanisms that have been implicated in cadmium tolerance .

Methodological approaches to investigate these mechanisms include:

  • Membrane transport assays using vesicles containing recombinant PCR6

  • Subcellular fractionation studies to track cadmium distribution

  • Proteomic analyses to identify PCR6 interaction partners

  • Electrophysiological studies to characterize transport properties

How can researchers effectively produce and purify functional recombinant PCR6 for in vitro studies?

Producing functionally active recombinant PCR6 requires careful optimization of expression and purification protocols:

Expression system optimization:

  • E. coli expression: Most common approach using BL21(DE3) strain with pET vector systems

  • Induction conditions: Typically 0.5-1.0 mM IPTG at 16-18°C for 16-20 hours to enhance soluble protein production

  • Fusion tags: N-terminal His-tag is commonly used , though GST or MBP fusions may improve solubility

Purification protocol:

  • Cell lysis in Tris-based buffer (pH 8.0) containing appropriate protease inhibitors

  • Affinity chromatography using Ni-NTA for His-tagged protein

  • Size exclusion chromatography for higher purity

  • Storage in Tris/PBS-based buffer with 6% trehalose or 50% glycerol at -20°C/-80°C

Functional validation:

  • Circular dichroism to verify secondary structure

  • Size exclusion chromatography to confirm monodispersity

  • Metal binding assays to verify cadmium interaction

  • Liposome reconstitution for transport assays

How does PCR6 interact with phytohormone signaling pathways during cadmium stress response?

Emerging research suggests complex interactions between PCR6 and plant hormone signaling pathways:

  • ABA signaling pathway: Evidence indicates PCR6 expression may be modulated by ABA, a key stress hormone implicated in cadmium tolerance . Wild-type Arabidopsis shows higher resistance to cadmium compared to ABA-deficient mutants, suggesting hormonal regulation of cadmium tolerance mechanisms.

  • Calcium signaling integration: Studies with calcium-dependent protein kinases (CPKs) suggest potential regulation of metal transporters through phosphorylation . PCR6 may be subject to similar post-translational regulation.

  • Transcriptional regulation networks: Transcription factors involved in stress responses likely regulate PCR6 expression, forming a regulatory network that integrates multiple stress signals.

Research approaches to study these interactions include:

  • Treatment with phytohormones and analysis of PCR6 expression

  • Use of hormone signaling mutants to assess PCR6 regulation

  • Identification of promoter elements responsible for hormone responsiveness

  • Protein-protein interaction studies with signaling components

What are the functional differences between PCR6 and other members of the PCR protein family?

The PCR protein family in Arabidopsis includes several members with specialized functions:

PCR MemberPrimary FunctionExpression PatternCellular Localization
PCR1UnknownLow constitutiveMembrane-associated
PCR2Cadmium resistanceHighly induced by CdPlasma membrane
PCR6Cadmium resistanceInduced by CdMembrane-associated

Key differences between PCR6 and other family members:

  • PCR2 vs. PCR6: PCR2 has been more extensively characterized and shows strong upregulation upon Pseudomonas fluorescens interaction, enhancing cadmium resistance . PCR2-overexpressing transgenic lines demonstrate increased cadmium tolerance . PCR6 appears to function similarly but may have distinctive tissue specificity or kinetic properties.

  • Expression patterns: While multiple PCR family members respond to cadmium, the magnitude and kinetics of their response differ. PCR6 shows approximately 5-6 fold upregulation under cadmium stress .

  • Structural differences: Sequence variations among PCR family members likely confer different substrate affinities or regulatory properties. These differences may explain their non-redundant functions.

Research methodologies to study these differences include comparative expression analysis, protein interaction studies, and phenotypic analysis of knockout/overexpression lines for different PCR family members.

What experimental approaches can resolve contradictory data regarding PCR6 function in different plant tissues?

Researchers sometimes encounter conflicting results regarding PCR6 function across different experimental systems. Addressing these contradictions requires systematic methodological approaches:

  • Tissue-specific expression analysis:

    • Use tissue-specific promoters to drive PCR6 expression

    • Employ laser capture microdissection followed by qRT-PCR

    • Analyze tissue-specific transcriptomes under cadmium stress

  • Cell-type specific functional studies:

    • Create cell-type specific knockout lines using tissue-specific CRISPR systems

    • Develop tissue-specific overexpression lines

    • Perform cell-type specific cadmium accumulation measurements

  • Integration of multiple analytical techniques:

    • Combine transcriptomic, proteomic and metabolomic approaches

    • Use imaging techniques to track cadmium distribution (e.g., μXRF)

    • Apply mathematical modeling to integrate tissue-specific data

  • Standardized experimental conditions:

    • Control for plant developmental stage variations

    • Standardize cadmium exposure protocols (concentration, duration, application method)

    • Account for interactions with other environmental factors (light, temperature, other nutrients)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.