Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 7 (PCR7)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 7 (PCR7)

Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 7 (PCR7) is a protein derived from the model plant Arabidopsis thaliana. It is part of a family of proteins involved in heavy metal resistance, particularly cadmium (Cd), which is a toxic heavy metal that can severely impact plant growth and development. The PCR family, including PCR7, plays a crucial role in mediating cadmium resistance in plants by potentially regulating heavy metal transport and homeostasis.

Production and Sources of Recombinant PCR7

Recombinant PCR7 can be produced in various expression systems, including yeast, E. coli, baculovirus, and mammalian cells . This versatility allows researchers to choose the most suitable host for their specific applications, whether it be for biochemical studies, functional assays, or large-scale production.

Expression SystemDescription
YeastHigh purity, suitable for biochemical studies .
E. coliCommonly used for large-scale protein production .
BaculovirusUtilized for producing complex proteins in insect cells .
Mammalian CellsOffers post-translational modifications similar to those in plants .

Research Findings and Applications

Research on the PCR family, including PCR7, highlights its potential in enhancing plant resistance to heavy metals. By understanding how these proteins function, scientists can genetically engineer plants to better tolerate cadmium and other toxic metals, which is crucial for improving crop yields in polluted soils .

4.1. Cadmium Resistance Mechanisms

Cadmium resistance in plants involves several mechanisms, including reduced uptake, increased sequestration into vacuoles, and enhanced antioxidant defenses . Proteins like PCR7 may play a role in these processes by facilitating the transport of cadmium ions across cell membranes.

4.2. Potential Applications

  1. Bioremediation: Genetically modified plants expressing PCR7 could be used to clean up polluted soils by accumulating heavy metals without harming the plant.

  2. Agricultural Improvement: Enhancing cadmium resistance in crops can improve yields and reduce the risk of heavy metal contamination in the food chain.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PCR7; At3g18470; MYF24.19; Protein PLANT CADMIUM RESISTANCE 7; AtPCR7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-133
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PCR7
Target Protein Sequence
MEKQWTSGLFSCMEDSETACLTCFCPCVTFGRIADISDEGRTGCGRCGVFYGLICCVVGL PCLFSCTYRTKIRSKFGLPESPTSDCVTHFFCECCALCQEHRELKTRGLDPSIGWSGNMQ RTMAPPMSQQMMG
Uniprot No.

Target Background

Function
May be involved in heavy metal transport.
Database Links

KEGG: ath:AT3G18470

STRING: 3702.AT3G18470.1

UniGene: At.28577

Protein Families
Cornifelin family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is PCR7 and what is its functional role in Arabidopsis thaliana?

PCR7 (PLANT CADMIUM RESISTANCE 7, also known as AtPCR7) is a member of the PCR protein family in Arabidopsis thaliana. This protein is encoded by the PCR7 gene (At3g18470) and consists of 133 amino acids . PCR7 belongs to a family of proteins associated with heavy metal resistance mechanisms in plants, particularly involving cadmium tolerance and homeostasis. While specific research on PCR7 is limited compared to other family members like PCR8, its structural characteristics suggest a role in metal ion transport or sequestration within plant cells. The protein contains cysteine-rich domains that potentially function in metal binding, a characteristic feature of proteins involved in heavy metal detoxification pathways.

How does PCR7 expression relate to transposable elements in Arabidopsis?

Interestingly, while PCR7 itself is distinct from the RPP7 disease resistance gene, research has shown that some PCR family genes in Arabidopsis have complex regulatory mechanisms. For example, the RPP7 gene contains a Ty-1 COPIA-type retrotransposon (COPIA-R7) that influences its expression through alternative polyadenylation and H3K9me2 histone modification . This represents an important example of how transposable elements can be coopted for gene regulation in plants. Though not directly established for PCR7, such mechanisms may be relevant for understanding the regulation of PCR family genes and their responses to environmental stressors like heavy metal exposure.

What are the optimal conditions for storing and handling recombinant PCR7?

For optimal maintenance of recombinant PCR7 protein integrity:

Storage ParameterRecommended ConditionNotes
Long-term storage-20°C/-80°CAliquoting is necessary to avoid freeze-thaw cycles
Working stock4°CStable for up to one week
Physical formLyophilized powder or reconstituted solutionReconstituted samples should contain glycerol
Buffer compositionTris/PBS-based buffer, pH 8.0 with 6% trehaloseMaintains protein stability
AvoidRepeated freeze-thaw cyclesSignificantly reduces protein activity

The recombinant protein should be briefly centrifuged before opening the vial to ensure all material is at the bottom. When working with the protein, minimize exposure to room temperature to prevent degradation .

What is the recommended protocol for reconstituting lyophilized PCR7?

The following stepwise protocol is recommended for reconstitution:

  • Centrifuge the vial containing lyophilized protein briefly before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) to prevent freeze damage during storage

  • Aliquot the reconstituted protein into smaller volumes for single-use applications

  • Store aliquots at -20°C/-80°C for long-term storage

  • For working stocks, keep at 4°C for no longer than one week

This reconstitution approach minimizes protein degradation while maximizing experimental utility.

What PCR techniques are most effective for studying PCR7 expression in plant tissues?

For analyzing PCR7 expression in Arabidopsis, several PCR approaches have proven effective:

PCR MethodApplicationAdvantagesConsiderations
Direct PCR from tissueGenotyping & expression screeningRapid; minimal tissue damageMay have lower sensitivity for low-abundance transcripts
CutTip methodGenotypingHigh accuracy; minimal tissue processingWorks well with Arabidopsis leaf tissue
Line-PCRGenotyping & expression analysisFastest; least tissue damage; high accuracySimple, requires minimal specialized equipment
qRT-PCRQuantitative expression analysisPrecise quantificationRequires RNA extraction and careful control design

When conducting expression analysis of PCR7, the CutTip or Line-PCR methods allow for rapid screening with minimal tissue disruption. For a leaf tissue sample, a 20 μL pipette tip can be used to pierce the leaf against a flat wooden surface, then the tip placed into PCR solution and pipetted up and down approximately 10 times . This approach minimizes PCR inhibition that can occur with excess plant tissue.

How can researchers distinguish between PCR7 and other members of the PCR family?

Distinguishing between PCR family members requires careful experimental design:

  • Primer design: Gene-specific primers must target unique regions that differ among PCR family members. For PCR7-specific amplification, primers should target the following regions:

    • Regions with unique sequence differences between PCR7 and related genes (particularly PCR8)

    • UTR regions that typically show greater variation than coding sequences

    • Exon-exon junctions specific to PCR7 transcript structure

  • Antibody-based approaches: When using immunodetection methods:

    • Use epitope-specific antibodies targeting unique regions of PCR7

    • For recombinant His-tagged PCR7, anti-His antibodies can detect the protein, but cannot distinguish from other His-tagged proteins

    • Western blot analysis should include appropriate size controls (PCR7 protein is approximately 15 kDa plus tag size)

  • Expression pattern analysis: PCR7 can be distinguished from other family members based on:

    • Tissue-specific expression patterns

    • Differential responses to cadmium and other heavy metal stressors

    • Temporal expression dynamics under stress conditions

What experimental approaches are recommended for studying PCR7 protein-protein interactions?

For investigating protein interaction networks involving PCR7:

MethodApplicationStrengthsLimitations
Yeast two-hybridIdentifying direct interaction partnersCan screen librariesMay produce false positives
Co-immunoprecipitationValidating interactions in plant cellsDetects native complexesRequires specific antibodies
Pull-down assaysIn vitro interaction validationUses recombinant His-tagged PCR7May not reflect in vivo conditions
BiFCVisualizing interactions in living cellsProvides subcellular localizationFusion proteins may affect function
RNA-protein interactionIf PCR7 has RNA-binding propertiesCan identify RNA targetsComplex methodology

For RNA-protein interaction studies with PCR7, approaches like the RNA immunoprecipitation (RIP) protocol used for AtGRP7 could be adapted. This involves UV crosslinking to covalently link RNA and proteins, followed by capture with antisense oligonucleotides. For enhanced efficiency, locked nucleic acid (LNA)/DNA oligonucleotides and tandem capture with two rounds of pulldown may be implemented .

How should researchers design experiments to assess PCR7's role in cadmium stress response?

A comprehensive experimental approach should include:

  • Expression analysis under varied cadmium concentrations:

    • Monitor PCR7 transcript levels in wild-type plants exposed to gradient concentrations (0-200 μM) of CdCl₂

    • Compare expression in roots versus shoots to determine tissue-specific responses

    • Include time-course measurements (0h, 6h, 12h, 24h, 48h) to capture temporal dynamics

  • Functional genetic studies:

    • Generate and characterize pcr7 knockout/knockdown lines

    • Create PCR7 overexpression lines

    • Compare cadmium tolerance phenotypes between these genetic variants and wild-type

    • Measure parameters including:

      • Biomass accumulation

      • Root elongation

      • Chlorophyll content

      • Lipid peroxidation (MDA content)

      • Antioxidant enzyme activities

  • Cadmium accumulation and distribution:

    • Quantify Cd content in different tissues using ICP-MS

    • Compare Cd compartmentalization between wild-type and pcr7 mutant plants

    • Analyze subcellular localization of Cd using techniques like X-ray fluorescence microscopy

  • Protein function assays:

    • Test recombinant PCR7 for direct Cd binding capacity in vitro

    • Assess Cd transport activity in heterologous systems (yeast, Xenopus oocytes)

    • Evaluate localization of GFP-tagged PCR7 in plant cells with and without Cd exposure

What are common challenges when working with recombinant PCR7 and how can they be addressed?

ChallengePotential CausesSolutions
Poor protein solubilityImproper reconstitution; Protein aggregationUse recommended buffer; Reconstitute at lower concentration; Add stabilizing agents
Reduced activity after storageFreeze-thaw damage; Improper storage conditionsPrepare single-use aliquots; Maintain proper temperature; Add glycerol as cryoprotectant
Inconsistent binding assaysProtein denaturation; Suboptimal buffer conditionsOptimize buffer pH and salt concentration; Include positive controls
Degradation during experimentsProteolytic activity; Unstable conditionsAdd protease inhibitors; Keep samples on ice; Minimize handling time
Low yield in protein interaction studiesWeak or transient interactionsUse crosslinking agents; Optimize binding conditions; Consider membrane solubilization

When performing experiments with recombinant PCR7, always include appropriate controls to validate results:

  • Positive controls: Use well-characterized protein-metal interactions

  • Negative controls: Include non-metal binding proteins in parallel experiments

  • Technical replicates: Perform at least three independent measurements

  • Biological replicates: Use independent protein preparations

How can researchers validate that recombinant PCR7 protein maintains native conformation?

To ensure the recombinant His-tagged PCR7 protein maintains its native conformation:

  • Structural analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Limited proteolysis to examine accessible cleavage sites

    • Thermal shift assays to evaluate protein stability

  • Functional validation:

    • Metal binding assays using isothermal titration calorimetry

    • Competitive binding assays with known metal chelators

    • Comparison of activity with native protein extracted from Arabidopsis

  • Quality control checks:

    • SDS-PAGE to confirm size and purity (>90% as specified in product information)

    • Western blot detection using both anti-His and PCR7-specific antibodies

    • Dynamic light scattering to assess aggregation state

What statistical approaches are recommended for analyzing PCR7 expression data?

When analyzing PCR7 expression data from qRT-PCR experiments:

  • Data normalization:

    • Use multiple reference genes (at least 3) for normalization

    • Validate reference gene stability under experimental conditions

    • Consider geometric averaging of multiple reference genes

  • Statistical testing:

    • For comparing two conditions: Student's t-test or Mann-Whitney U test (non-parametric)

    • For multiple conditions: One-way ANOVA followed by post-hoc tests (Tukey's or Dunnett's)

    • For time-course experiments: Two-way ANOVA or repeated measures ANOVA

  • Quantification methods:

    • Use the 2^(-ΔΔCt) method for relative quantification

    • Include standard curves for absolute quantification

    • Report reaction efficiencies for all primer pairs

  • Data presentation:

    • Include biological replicates (n≥3) and technical replicates (n≥3)

    • Report statistical significance using appropriate notation

    • Provide raw data and detailed experimental protocols for reproducibility

Ensure all qPCR experiments follow MIQE guidelines (Minimum Information for Publication of Quantitative Real-Time PCR Experiments) to maximize reproducibility and reliability .

How might PCR7 research contribute to understanding plant metal homeostasis networks?

Future research on PCR7 could elucidate several aspects of plant metal homeostasis:

  • Integrative network analysis:

    • Map interactions between PCR7 and other metal transport/sequestration proteins

    • Identify regulatory pathways controlling PCR7 expression under stress

    • Determine cross-talk between cadmium response and other stress pathways

  • Evolutionary conservation:

    • Compare PCR family proteins across plant species

    • Identify conserved domains and species-specific adaptations

    • Trace the evolutionary history of metal resistance mechanisms in plants

  • Systems biology approaches:

    • Develop mathematical models of metal transport and sequestration

    • Predict the effects of PCR7 modifications on whole-plant metal homeostasis

    • Identify potential intervention points for enhancing metal tolerance

What potential applications exist for PCR7 in phytoremediation research?

PCR7 research could advance phytoremediation technologies through:

  • Bioengineering approaches:

    • Develop plants with enhanced PCR7 expression for increased cadmium uptake

    • Create PCR7 variants with modified metal binding specificity or capacity

    • Explore tissue-specific expression to target accumulation in harvestable tissues

  • Field application research:

    • Test PCR7-overexpressing plants in contaminated soils

    • Evaluate biomass production and metal extraction efficiency

    • Assess ecological impacts and sustainability

  • Comparative analyses:

    • Determine the relative efficiency of PCR7 versus other metal-binding proteins

    • Identify optimal combinations of genes for multi-metal remediation

    • Evaluate cross-species functionality in high-biomass remediation plants

How can advanced molecular techniques enhance PCR7 functional characterization?

Emerging techniques that could advance PCR7 research include:

  • CRISPR-Cas9 genome editing:

    • Generate precise modifications in PCR7 protein domains

    • Create conditional knockout systems for temporal control

    • Develop base editing approaches for specific amino acid substitutions

  • Advanced imaging techniques:

    • Use super-resolution microscopy to visualize PCR7 localization

    • Employ FRET-based sensors to monitor interactions in real-time

    • Implement live-cell imaging to track PCR7 dynamics during stress

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Identify molecular signatures associated with PCR7 function

    • Map complete response networks under cadmium stress

  • Structural biology approaches:

    • Determine high-resolution structure of PCR7 using cryo-EM or X-ray crystallography

    • Model metal binding sites and conformational changes

    • Design structure-guided modifications to enhance function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.