Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 8 (PCR8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PCR8; At1g52200; F9I5.19; Protein PLANT CADMIUM RESISTANCE 8; AtPCR8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PCR8
Target Protein Sequence
MGRVTTPSEEDSNNGLPVQQPGTPNQRTRVPVSQFAPPNYQQANVNLSVGRPWSTGLFDC QADQANAVLTTIVPCVTFGQIAEVMDEGEMTCPLGTFMYLLMMPALCSHWVMGSKYREKM RRKFNLVEAPYSDCASHVLCPCCSLCQEYRELKIRNLDPSLGWNGILAQGQGQYEREAPS FAPTNQYMSK
Uniprot No.

Target Background

Function
Putative involvement in heavy metal transport.
Database Links

KEGG: ath:AT1G52200

STRING: 3702.AT1G52200.1

UniGene: At.37647

Protein Families
Cornifelin family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 8 (PCR8)?

Protein PLANT CADMIUM RESISTANCE 8 (PCR8) is an Arabidopsis thaliana protein involved in heavy metals transport, particularly cadmium. It belongs to the cornifelin family of proteins and plays a significant role in the plant's response to heavy metal stress . PCR8 has potential functional interactions with several proteins, including F-box/kelch-repeat proteins, root UVB sensitive proteins, and translationally controlled tumor proteins, suggesting its involvement in multiple cellular pathways beyond metal transport .

The protein contains 190 amino acids and functions within complex regulatory networks that help Arabidopsis manage cadmium exposure, which is particularly important given the environmental concerns related to heavy metal contamination in soils.

What methods are used to clone and express PCR8 for research purposes?

Several methodological approaches can be used to clone and express PCR8:

Vector-Based Cloning System:

  • The pCR8/GW/TOPO TA Cloning Kit provides an efficient system for PCR8 cloning with 5-minute processing time

  • The vector contains 3′-T overhangs for direct ligation of Taq-amplified PCR products

  • Sequencing primer sites within 55 bp of insertion ensure you sequence more insert and less vector

Experimental Protocol:

  • Extract total RNA from Arabidopsis seedlings or floral buds using Trizol

  • Treat with DNase I to remove genomic DNA contamination

  • Synthesize cDNA using a one-step gDNA removal and cDNA synthesis kit

  • Amplify the PCR8 coding sequence using gene-specific primers

  • Clone the amplified product into pCR8/GW/TOPO vector

  • Transform into competent E. coli (typically TOP10 strain)

  • Select transformants using spectinomycin resistance marker

  • Verify inserts by sequencing with pCR8-F1 primer

  • Transfer to expression vectors using Gateway recombination technology

This approach has been successfully used for numerous Arabidopsis proteins, as demonstrated in the Arabidopsis Membrane Interactome Project, which used this system to create verified clones from seedlings and flowers .

How can PCR8 expression be analyzed under cadmium stress conditions?

Analyzing PCR8 expression under cadmium stress involves several methodological approaches:

RT-PCR Analysis:

  • Grow Arabidopsis seedlings on MS media with or without cadmium treatment (typically 40 μM CdCl₂)

  • Harvest tissue at different time points after treatment (e.g., 0, 6, 12, 24, 48 hours)

  • Extract total RNA using Trizol or equivalent reagent

  • Synthesize cDNA using reverse transcriptase

  • Perform quantitative RT-PCR using PCR8-specific primers

  • Normalize gene expression to reference genes (EF-1 and UBQ10 are commonly used)

Promoter Analysis:

  • The PCR8 promoter can be amplified and cloned into a GUS reporter vector such as pMDC163

  • Transgenic plants harboring the ProPCR8::GUS construct can be analyzed for tissue-specific expression patterns

  • GUS staining after cadmium treatment reveals spatial and temporal expression patterns

Transcriptome Analysis:

  • RNA-seq provides comprehensive insights into global expression changes, including PCR8

  • Direct RNA sequencing using Nanopore technology offers advantages for identifying transcript isoforms

  • For PCR8 transcript analysis, mRNA isolation followed by library preparation with Nanopore direct RNA sequencing kit (SQK-RNA002) can be used

These methods have been successfully applied to study expression patterns of cadmium-responsive genes in Arabidopsis, revealing how gene expression changes correlate with stress adaptation mechanisms.

What experimental systems are effective for studying PCR8 function in cadmium tolerance?

Several experimental systems can be employed to study PCR8 function in cadmium tolerance:

Hydroponic and Agar-Based Growth Assays:

  • Grow seedlings on MS media containing different concentrations of cadmium (typically 0-100 μM)

  • Measure root length, rosette size, dry weight, and other growth parameters

  • Compare wild-type, knockout mutants, and overexpression lines to assess PCR8 contribution to tolerance

Field Experiments:

  • The "synchronized-genetic-perturbation-field-experiment" approach can reveal gene function under natural conditions

  • Similar to UVR8 studies, PCR8 function could be assessed across multiple locations with varying natural cadmium levels

  • Wild-type and PCR8 mutant plants can be grown at different locations ranging in latitude to assess environmental interactions

Physiological and Biochemical Assays:

  • Measure cadmium content in different tissues using atomic absorption spectroscopy

  • Quantify antioxidant enzyme activities (SOD, POD, CAT) to assess oxidative stress responses

  • Analyze phenolic compound content changes similar to measurements of kaempferol glycosides and quercetin glycosides in UVR8 studies

ParameterWild-typePCR8 MutantPCR8 Overexpression
Root length inhibition~44% reduction with Cd~27-30% reduction with Cd (expected based on similar genes)Greater reduction than WT (hypothesized)
SOD activityBaselineDecreased under Cd stressEnhanced under Cd stress
POD activityBaselineIncreased under Cd stressDecreased under Cd stress
CAT activityBaselineDecreased under Cd stressEnhanced under Cd stress

These experimental systems allow for comprehensive assessment of PCR8 function across multiple scales and conditions, providing insights into its specific role in cadmium tolerance mechanisms.

How can mutant lines be generated and screened to study PCR8 function?

Generating and screening PCR8 mutant lines involves several methodological steps:

T-DNA Insertion and CRISPR/Cas9 Mutant Generation:

  • For T-DNA insertions, obtain lines from repositories like the European Arabidopsis Stock Centre (uNASC)

  • For CRISPR/Cas9 mutants, design guide RNAs targeting PCR8

  • Create frameshift mutations in PCR8 coding sequence using CRISPR/Cas9

  • Generate both hypomorphic (reduced expression) and amorphic (null) mutants for comparative analysis

Screening Protocol:

Validation Methods:

  • Create complementation lines by introducing wild-type PCR8 into mutant background

  • Generate overexpression lines using the 35S promoter (35S::PCR8)

  • Use promoter-driven expression with native promoter (ProPCR8::PCR8-HA) for physiological relevance

This comprehensive approach allows for thorough characterization of PCR8 function through loss-of-function and gain-of-function strategies, providing insights into its role in cadmium tolerance mechanisms.

What are the key protein interactions of PCR8 and how can they be studied?

PCR8 interacts with several proteins as part of its function in cadmium resistance and related pathways:

Known PCR8 Protein Interactions from STRING Database:

Interacting ProteinDescriptionInteraction Score
K16N12.16Putative F-box/kelch-repeat protein At3g279100.791
RUS6Protein root UVB sensitive 60.695
TCTP2Translationally controlled tumor protein 20.695
F14M2.7GDSL esterase/lipase At1g338110.633
F20L16.150GDSL esterase/lipase At5g184300.598
UBQ10Polyubiquitin 100.557

Experimental Methods to Study Interactions:

  • Yeast Two-Hybrid (Y2H) Analysis:

    • Clone PCR8 CDS into pCR8/GW/TOPO vector and transfer to Y2H bait vector

    • Screen against Arabidopsis cDNA library to identify interacting proteins

    • Confirm interactions through targeted pairwise tests

  • Co-Immunoprecipitation (Co-IP):

    • Generate transgenic lines expressing tagged PCR8 (PCR8-HA or PCR8-GFP)

    • Perform immunoprecipitation using antibodies against the tag

    • Identify co-precipitated proteins by mass spectrometry

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create fusion constructs with PCR8 and potential interactors fused to split fluorescent protein fragments

    • Express in Arabidopsis protoplasts or Nicotiana benthamiana leaves

    • Visualize interactions through fluorescence microscopy

  • Membrane Interactome Analysis:

    • Leverage approaches used in the Arabidopsis Membrane Interactome Project

    • Clone PCR8 into appropriate vectors for membrane-based interaction studies

    • Screen for interactions with other membrane proteins

Understanding these protein interactions provides crucial insights into how PCR8 functions within broader cellular networks to mediate cadmium tolerance and related stress responses.

How does PCR8 contribute to antioxidant defense systems under cadmium stress?

PCR8's role in antioxidant defense systems under cadmium stress involves complex interactions with enzymatic and non-enzymatic components:

Regulation of Antioxidant Enzyme Activities:

Based on studies of cadmium tolerance mechanisms in Arabidopsis, proteins like PCR8 likely influence key antioxidant enzymes:

EnzymeActivity in Cd-Tolerant LinesPCR8's Potential Role
Superoxide Dismutase (SOD)Significantly decreased under Cd stress May downregulate SOD activity to balance ROS signaling
Peroxidase (POD)Significantly increased under Cd stress Likely enhances POD activity to detoxify H₂O₂
Catalase (CAT)Significantly decreased under Cd stress May modulate CAT levels for optimal ROS balance

Non-Enzymatic Antioxidant Regulation:

PCR8 may influence phenolic compound production, which serves as non-enzymatic antioxidants:

  • Studies of other stress-response proteins show effects on flavonoid biosynthesis

  • Similar to UVR8's effect on kaempferol glycosides, quercetin glycosides, and hydroxycinnamic acid derivatives

  • These compounds function as potent antioxidants and metal chelators

Experimental Approach to Study PCR8's Role:

  • Compare antioxidant enzyme activities between wild-type, PCR8 knockout, and PCR8 overexpression lines under cadmium stress

  • Quantify oxidative stress markers (lipid peroxidation, protein carbonylation, H₂O₂ levels)

  • Analyze transcriptional changes in genes encoding antioxidant enzymes

  • Measure glutathione and phytochelatin levels, which are critical for cadmium chelation and antioxidant defense

These analyses would provide comprehensive insights into how PCR8 contributes to the plant's antioxidant defense system under cadmium stress conditions.

What methodological approaches should be used to study natural variation in PCR8 across Arabidopsis ecotypes?

Studying natural variation in PCR8 requires systematic approaches across multiple levels of analysis:

Genetic Variation Analysis:

  • Sequence PCR8 locus across diverse Arabidopsis accessions (50-100 ecotypes representing global distribution)

  • Identify single nucleotide polymorphisms (SNPs), insertions/deletions, and copy number variations

  • Analyze promoter regions to identify potential regulatory variants

  • Characterize haplotype structure and linkage disequilibrium patterns

Phenotypic Characterization:

  • Grow different ecotypes under standardized cadmium stress conditions

  • Measure cadmium tolerance parameters (root growth, biomass, chlorophyll content)

  • Quantify cadmium accumulation in roots and shoots

  • Analyze PCR8 expression levels across ecotypes using qRT-PCR

Quantitative Trait Loci (QTL) Mapping:

  • Use recombinant inbred line (RIL) populations derived from divergent parents (e.g., Col-0 and Bur-0)

  • Perform QTL mapping to identify genomic regions associated with cadmium tolerance

  • Determine if PCR8 co-localizes with identified QTLs

  • Based on previous QTL studies for cadmium resistance, expect to find 3-4 major QTLs explaining approximately 50% of phenotypic variation

QTL Location ExamplePositionPhenotypic Variation Explained
Chromosome 45.6-6.9 Mb16%
Chromosome 413.2-17.7 Mb12%
Chromosome 52.9-5.3 Mb23%

Genome-Wide Association Studies (GWAS):

  • Phenotype a large collection of Arabidopsis accessions (>300) for cadmium tolerance

  • Use available SNP data or whole-genome resequencing

  • Perform GWAS to identify associations between genetic variants and phenotypes

  • Determine if PCR8 variants show significant associations with cadmium tolerance traits

These methodological approaches would provide comprehensive insights into how natural variation in PCR8 contributes to differential cadmium tolerance across Arabidopsis ecotypes, potentially identifying beneficial alleles for crop improvement.

How does PCR8 integrate with other cadmium response pathways in Arabidopsis?

PCR8 functions within a complex network of cadmium response pathways in Arabidopsis:

Integration with Cadmium Uptake and Transport Systems:

PCR8 likely interacts with key cadmium transport pathways, including:

  • Uptake System Interactions:

    • May regulate expression of IRT1 and Nramp1, key transporters responsible for cadmium uptake into root cells

    • Similar proteins have been shown to upregulate these transporters under cadmium stress

  • Translocation Pathway Coordination:

    • Potential regulation of HMA2 and HMA4, which control root-to-shoot cadmium translocation

    • Cadmium-tolerant transgenic lines show downregulation of these transporters, reducing translocation to sensitive shoot tissues

  • Subcellular Compartmentalization:

    • May influence vacuolar sequestration through CAX and MTP transporters

    • Could affect PC-Cd complex formation and transport into vacuoles

Experimental Evidence from Related Studies:

Research on cadmium tolerance mechanisms reveals potential PCR8 pathway integration:

Pathway ComponentExpression in Cd-Tolerant LinesPotential PCR8 Interaction
AtIRT1Significantly upregulated PCR8 may enhance expression
AtNramp1Significantly upregulated PCR8 may enhance expression
AtHMA2Significantly downregulated PCR8 may suppress expression
AtHMA4Significantly downregulated PCR8 may suppress expression
AtPCS1Varied regulation Complex regulatory relationship
AtGSH1Varied regulation Complex regulatory relationship

Methodological Approach to Study Integration:

  • Perform transcriptome analysis (RNA-seq) comparing wild-type and PCR8 mutants under cadmium stress

  • Use ChIP-seq to identify PCR8-regulated genes if PCR8 functions as a transcription factor

  • Construct double mutants between PCR8 and other cadmium pathway genes to assess genetic interactions

  • Use synchronized field experiments across multiple locations to evaluate PCR8 function under varying environmental conditions

This integrated approach would reveal how PCR8 functions within the broader cadmium response network in Arabidopsis, providing insights for engineering enhanced heavy metal tolerance.

What are the most effective strategies for engineering PCR8 to enhance cadmium tolerance in plants?

Engineering PCR8 for enhanced cadmium tolerance requires strategic approaches at multiple levels:

Genetic Modification Strategies:

  • Expression Level Optimization:

    • Overexpress PCR8 using constitutive promoters (35S) for broad expression

    • Use tissue-specific promoters to target expression to roots for cadmium sequestration

    • Employ stress-inducible promoters for context-appropriate expression

    • Based on similar genes, expect 30-40% improvement in cadmium tolerance through optimized expression

  • Protein Engineering Approaches:

    • Identify and modify key functional domains based on structural analysis

    • Create variants with enhanced metal-binding capacity

    • Introduce mutations at regulatory sites to enhance activity under stress conditions

    • Design chimeric proteins combining PCR8 with domains from other metal-binding proteins

  • CRISPR/Cas9 Base Editing:

    • Use targeted C-to-T base editing in the PCR8 coding or regulatory regions

    • Design guide RNAs targeting specific codons for optimization

    • Verify edits through sequencing with pCR8-F1 primer

Vector Construction and Transformation Protocol:

  • Cloning and Vector Assembly:

    • Clone PCR8 variants into pCR8/GW/TOPO entry vector

    • Transfer to appropriate plant expression vectors using Gateway recombination

    • Include reporter tags (GFP, HA) for protein localization and interaction studies

  • Plant Transformation:

    • Transform Arabidopsis using Agrobacterium-mediated floral dip method

    • Select transformants using appropriate antibiotic or herbicide markers

    • Verify transgene insertion through PCR and expression through RT-PCR

  • Phenotypic Validation:

    • Test transgenic lines under varying cadmium concentrations (0-100 μM)

    • Measure root growth, biomass, and physiological parameters

    • Quantify cadmium accumulation in different tissues

    • Analyze expression of cadmium-responsive genes and antioxidant enzyme activities

This comprehensive engineering approach would leverage fundamental understanding of PCR8 function to develop plants with enhanced cadmium tolerance, potentially contributing to phytoremediation strategies for metal-contaminated soils.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.