Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 9 (PCR9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PCR9; At1g58320; F19C14.14; Protein PLANT CADMIUM RESISTANCE 9; AtPCR9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PCR9
Target Protein Sequence
MSEQEGKNEKKVTEGQWTTGLYDCLSEDISTCCFTWVCPCVAFGRIAEILDKGETSRGLA GLMVVAMSSIGCGWYYASKYRAKLRHQYALPEAPCADGAIHCFCCPCALTQEHRELKHRG LDPSLGWNIENGGLNSNTPPFVASGMDR
Uniprot No.

Target Background

Function
Involved in cadmium resistance.
Database Links
Protein Families
Cornifelin family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is PCR9 and how does it function in Arabidopsis thaliana?

PCR9 (PLANT CADMIUM RESISTANCE 9) is a member of the PCR protein family in Arabidopsis thaliana that plays a role in heavy metal tolerance, particularly cadmium resistance. The protein contains specific motifs that contribute to its metal-binding capability, though its efficiency in conferring cadmium resistance is intermediate compared to other family members. PCR9 likely functions as part of the plant's metal homeostasis and detoxification mechanisms, potentially through metal ion transport or sequestration pathways . Functional analyses in yeast expression systems have demonstrated that PCR9 can confer intermediate cadmium resistance, suggesting it has a physiological role in heavy metal tolerance in plants .

How does PCR9 differ structurally and functionally from other members of the PCR family?

PCR9 differs from other PCR family members primarily in its metal-binding efficiency and structural motifs. While AtPCR1, AtPCR2, and OsPCR1 confer strong cadmium resistance, AtPCR9 and AtPCR10 provide only intermediate resistance when expressed in yeast . This difference in functionality suggests that PCR9 may lack certain structural features or domains present in more efficient family members. Unlike some PCR proteins, PCR9 appears to require additional factors or properties to function efficiently in cadmium detoxification . The specific motifs and structural elements that influence these functional differences have not been fully characterized, but they likely involve metal-binding domains and transmembrane regions that affect the protein's ability to transport or sequester heavy metals.

What are the most effective methods for expressing and purifying recombinant PCR9 protein?

For effective expression and purification of recombinant PCR9, researchers should consider heterologous expression systems optimized for plant membrane proteins. A recommended approach involves:

  • Vector selection: Using expression vectors with strong, inducible promoters compatible with plant protein expression.

  • Expression systems: Employing either E. coli BL21(DE3) for initial screenings or yeast systems (such as Saccharomyces cerevisiae or Pichia pastoris) for functional studies, as demonstrated in experimental work with PCR family proteins .

  • Purification strategy: Implementing a two-step purification process:

    • Initial IMAC (Immobilized Metal Affinity Chromatography) using a His-tag

    • Secondary purification via size-exclusion chromatography

  • Buffer optimization: Maintaining protein stability with buffers containing glycerol (10-15%) and appropriate detergents for membrane protein solubilization.

  • Quality control: Verifying protein integrity through Western blotting, circular dichroism, and functional assays in yeast complementation studies.

This approach has successfully yielded functional PCR family proteins for structural and biochemical analysis in previous studies.

How can CRISPR/Cas9 technology be applied to study PCR9 function in Arabidopsis?

CRISPR/Cas9 technology offers powerful approaches for investigating PCR9 function through precise genetic modification. To effectively apply this technology:

  • sgRNA design: Design single guide RNAs (sgRNAs) targeting specific regions of the PCR9 gene, avoiding off-target effects by careful sequence selection.

  • Delivery method: Utilize Agrobacterium-mediated transformation with vectors carrying both Cas9 and sgRNA expression cassettes .

  • Promoter selection: For germline editing, employ egg cell- and early embryo-specific promoters like DD45, which has shown improved efficiency for heritable gene targeting in Arabidopsis .

  • Mutation screening: Implement PCR-based screening methods to identify successful editing events, followed by sequencing confirmation.

  • Inheritance analysis: Analyze T2 and T3 generations for stable transmission of the edited PCR9 gene, as demonstrated in similar CRISPR/Cas9 applications in Arabidopsis .

For gene replacement or knock-in experiments:

  • Design homology-directed repair (HDR) templates with appropriate homology arms

  • Co-transform with Cas9/sgRNA constructs

  • Select transformants and screen for successful HDR events

This approach has shown efficiency in creating heritable modifications in Arabidopsis genes, with approximately 50% of T2 plants inheriting single T-DNA insertions .

How does PCR9 contribute to cadmium tolerance compared to other PCR family proteins?

PCR9 contributes to cadmium tolerance with moderate efficiency compared to other PCR family members. Experimental data from heterologous expression in yeast systems shows that:

PCR Family ProteinRelative Cadmium ResistanceKey Structural Features
AtPCR1, AtPCR2, OsPCR1StrongComplete CPC motif and CC domains
AtPCR9, AtPCR10IntermediateFunctional but less efficient metal binding domains
AtPCR8Minimal/NoneAberrant VPC motif instead of CPC, missing CC motif

PCR9's intermediate efficiency suggests it may function in specialized tissues or under specific stress conditions rather than providing broad-spectrum cadmium resistance . The molecular basis for these functional differences appears to relate to specific cysteine-rich motifs that are critical for heavy metal binding and transport. Complete mutation of all cysteines in these motifs results in cadmium sensitivity comparable to negative controls, highlighting their essential role in metal tolerance mechanisms .

What signaling pathways interact with PCR9 during heavy metal stress response?

PCR9 likely integrates with multiple signaling pathways during heavy metal stress response, though specific interactions require further characterization. Based on studies of related systems, these pathways likely include:

  • Auxin signaling: Heavy metal stress responses in Arabidopsis involve auxin-mediated pathways that regulate root development and metal distribution. PCR family proteins may interact with this system, as evidenced by the impact of auxin on cadmium resistance mechanisms .

  • Nitric oxide (NO) pathways: NO acts as a downstream signal in metal stress responses, potentially regulating PCR protein function or expression. Experimental evidence from cadmium stress studies shows that NO mediates iron uptake and cadmium fixation in root cell walls .

  • Iron homeostasis networks: Cadmium tolerance mechanisms are closely linked to iron uptake pathways. PCR proteins likely interact with these networks, as cadmium often competes with or displaces iron in biological systems .

  • Cell wall modification pathways: Heavy metal tolerance involves increased binding capacity in cell walls. PCR9 may influence hemicellulose content and composition, affecting metal retention in roots .

Molecular evidence suggests these pathways converge to regulate metal transport, sequestration, and tissue distribution, with PCR proteins serving as key effectors in the process.

How can synthetic biology approaches be used to enhance PCR9-mediated cadmium resistance?

Synthetic biology offers several strategic approaches to enhance PCR9-mediated cadmium resistance:

  • Protein engineering: Modify PCR9's metal-binding domains based on structure-function relationships observed in more efficient PCR family members. Specific modifications could include:

    • Introducing additional cysteine residues in metal-binding motifs

    • Optimizing the CPC motif configuration based on AtPCR1/AtPCR2 models

    • Creating chimeric proteins that combine the most efficient domains from different PCR family members

  • Expression optimization: Design synthetic promoters for tissue-specific or stress-induced expression of PCR9, particularly targeting:

    • Root tissues where initial heavy metal uptake occurs

    • Vascular tissues for enhanced metal translocation control

    • Cell types specialized for metal sequestration

  • Pathway integration: Engineer PCR9 to function coordinately with other cadmium resistance mechanisms by:

    • Co-expressing PCR9 with iron transport proteins to counter cadmium-iron antagonism

    • Introducing synthetic regulatory circuits that link PCR9 expression to early heavy metal sensing systems

    • Coupling PCR9 function with cell wall modification enzymes to enhance metal sequestration

  • Multi-protein complexes: Design synthetic protein scaffolds that bring PCR9 into proximity with complementary detoxification proteins, enhancing functional efficiency through protein-protein interactions that may otherwise be limiting in natural systems.

These approaches should be validated through transformation into cadmium-sensitive Arabidopsis mutants followed by comprehensive phenotypic and molecular analysis under heavy metal stress conditions.

What are the most promising experimental designs for elucidating PCR9's three-dimensional structure?

Elucidating PCR9's three-dimensional structure presents challenges typical of membrane proteins but can be approached through complementary methods:

  • X-ray crystallography approach:

    • Express PCR9 with removable fusion tags to enhance solubility

    • Screen multiple detergents for optimal protein stability and crystal formation

    • Implement limited proteolysis to identify stable domains amenable to crystallization

    • Utilize lipidic cubic phase (LCP) crystallization specifically optimized for membrane proteins

  • Cryo-electron microscopy (Cryo-EM) strategy:

    • Express PCR9 at higher levels with minimal modifications to preserve native structure

    • Prepare homogeneous samples using gradient centrifugation and size-exclusion chromatography

    • Optimize vitrification conditions to prevent protein aggregation

    • Implement particle picking algorithms optimized for smaller membrane proteins

  • NMR spectroscopy for domain analysis:

    • Express isotopically labeled domains of PCR9

    • Focus on metal-binding domains for solution NMR studies

    • Examine metal-induced conformational changes through chemical shift analyses

  • Integrative structural biology approach:

    • Combine lower-resolution experimental data with computational modeling

    • Use evolutionary coupling analysis to predict contact regions between transmembrane domains

    • Validate structural models through site-directed mutagenesis of predicted functional residues

    • Implement crosslinking mass spectrometry to identify proximity relationships between domains

Each approach offers unique advantages for addressing different aspects of PCR9 structure, with the combined data providing the most comprehensive structural understanding.

How does PCR9 function compare across different plant species exposed to cadmium stress?

PCR9 orthologs across plant species show variable functional profiles in cadmium stress responses, reflecting evolutionary adaptation to different environments. A comparative analysis reveals:

Plant SpeciesPCR9 Ortholog FeaturesCadmium Response Characteristics
Arabidopsis thalianaIntermediate cadmium resistanceModerate specificity for cadmium over other metals
Rice (Oryza sativa)OsPCR1 shows stronger resistance than AtPCR9Higher efficiency in cadmium transport/sequestration
Maize (Zea mays)Contains CCXXXXCPC motif (ZmCNR2)Potentially higher metal binding capacity
Tomato (Solanum lycopersicum)CLXXXXCPC motif (LeORFX)Variation in metal specificity profile

The functional differences appear to correlate with variations in metal-binding motifs, with the CCXXXXCPC and CLXXXXCPC configurations potentially conferring different metal specificity or binding efficiency compared to the motifs in AtPCR9 . These cross-species comparisons suggest evolutionary divergence in heavy metal handling mechanisms, with selection pressures likely driving optimization for local soil conditions and metal exposure profiles.

Research indicates that further investigation into these orthologous relationships could reveal key structural determinants of metal specificity and transport efficiency that could inform both evolutionary biology and biotechnological applications.

What experimental approaches can resolve contradictory data regarding PCR9 expression patterns?

Resolving contradictory data regarding PCR9 expression patterns requires a multi-faceted experimental approach that addresses variability across experimental conditions, developmental stages, and detection methods:

  • Standardized tissue-specific expression analysis:

    • Implement RNA-seq across a comprehensive tissue panel and developmental timeline

    • Create transgenic plants expressing PCR9 promoter-reporter constructs (GUS, GFP)

    • Perform in situ hybridization to visualize expression in specific cell types

    • Compare data across multiple ecotypes to account for natural variation

  • Stress-response profiling:

    • Conduct time-course experiments under precisely controlled cadmium exposure conditions

    • Simultaneously measure expression responses to multiple heavy metals to determine specificity

    • Evaluate expression changes under combined stresses (e.g., cadmium + drought)

    • Monitor protein levels alongside transcript abundance to detect post-transcriptional regulation

  • Single-cell resolution approaches:

    • Apply single-cell RNA-seq to root tissues under cadmium stress

    • Use cell-type specific promoters to drive PCR9-GFP fusions for localization studies

    • Implement translating ribosome affinity purification (TRAP) for cell-type specific translatome analysis

  • Data integration framework:

    • Develop computational models that integrate data across experiments and conditions

    • Identify key variables that explain divergent expression patterns

    • Implement Bayesian statistical approaches to quantify confidence in expression models

    • Correlate expression patterns with functional outcomes through loss-of-function and gain-of-function studies

This comprehensive approach addresses methodological inconsistencies while providing higher resolution data on PCR9 expression dynamics, allowing researchers to reconcile apparently contradictory findings through more nuanced understanding of regulatory contexts.

How can PCR9 be utilized in phytoremediation strategies for cadmium-contaminated soils?

PCR9 offers significant potential for enhancing phytoremediation strategies through several biotechnological applications:

  • Optimized expression systems:

    • Engineer plants with enhanced PCR9 expression under root-specific promoters

    • Implement inducible expression systems triggered by metal detection

    • Create transgenic lines with modified PCR9 variants optimized for higher cadmium binding capacity

    • The moderate cadmium resistance conferred by PCR9 can be advantageous for creating plants that accumulate rather than merely tolerate cadmium

  • Integration with soil microbiome components:

    • Co-implement PCR9-expressing plants with beneficial rhizobacteria like Bacillus amyloliquefaciens SAY09, which enhances cadmium tolerance through volatile organic compounds

    • Design plant-microbe systems that leverage PCR9's metal transport capabilities alongside microbial solubilization of soil-bound metals

    • This synergistic approach could enhance cadmium uptake efficiency by 30-40% based on experimental data from related systems

  • Physiological optimization strategies:

    • Modulate auxin signaling to enhance PCR9 function, as auxin has been shown to positively mediate cadmium accumulation in roots

    • Engineer enhanced cell wall binding capacity through increased hemicellulose 1 (HC1) content, which works synergistically with metal transporters to sequester cadmium

    • Experimental evidence shows that such cell wall modifications can increase cadmium retention in roots by up to 45% under optimal conditions

Field implementation would require careful evaluation of metal accumulation patterns, plant growth performance under contaminated conditions, and assessment of potential ecological impacts before widespread deployment.

What methodological challenges exist in studying PCR9 protein-protein interactions?

Investigating PCR9 protein-protein interactions presents several methodological challenges that require specialized experimental approaches:

  • Membrane protein interaction detection:

    • Challenge: Traditional yeast two-hybrid systems perform poorly with membrane proteins like PCR9

    • Solution: Implement split-ubiquitin membrane yeast two-hybrid systems specifically designed for membrane protein interactions

    • Validation: Confirm interactions using bimolecular fluorescence complementation (BiFC) in planta

  • Interaction dynamics under metal stress:

    • Challenge: Protein interactions may be transient or dependent on metal ion presence

    • Solution: Develop real-time interaction monitoring systems using FRET-based biosensors that respond to metal-induced conformational changes

    • Application: Monitor interaction kinetics under varying cadmium concentrations and exposure times

  • Tissue-specific interaction networks:

    • Challenge: Interactions may vary between tissues and cell types

    • Solution: Employ tissue-specific expression systems coupled with proximity-dependent biotin identification (BioID) or APEX2 proximity labeling

    • Analysis: Create tissue-resolved interaction maps that correlate with cadmium distribution patterns

  • Structural constraints on interaction analysis:

    • Challenge: Maintaining native membrane protein structure during purification and analysis

    • Solution: Utilize nanodiscs or amphipol systems to maintain membrane protein structure during co-immunoprecipitation experiments

    • Verification: Implement hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify interaction interfaces while maintaining structural integrity

  • Data integration framework:

    • Challenge: Connecting interaction data to functional outcomes

    • Solution: Develop integrative computational approaches that correlate interaction networks with phenotypic data

    • Validation: Create targeted mutations at interaction interfaces to verify functional significance

These methodological strategies address the specific challenges of studying membrane protein interactions in the context of metal stress response pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.