Recombinant Arabidopsis thaliana Protein RER1A (RER1A)

Shipped with Ice Packs
In Stock

Description

Functional Insights

RER1A facilitates ER retention of specific membrane proteins by recognizing transmembrane domain-based sorting signals, a mechanism conserved from yeast (Saccharomyces cerevisiae) to plants . Experimental findings include:

  • Functional complementation: Recombinant AtRER1A fully rescues Sec12p mislocalization in yeast rer1 mutants, demonstrating evolutionary conservation .

  • Tissue-specific expression: Native RER1A shows elevated expression in roots and floral buds, correlating with high secretory activity .

  • Subfunctionalization: AtRER1A shares 85% identity with AtRER1B but only ~50% with AtRER1C1, suggesting divergent roles within the gene family .

Production and Purification

Commercial and research-grade recombinant RER1A is produced in E. coli systems. Key protocols include:

ParameterSpecification
Expression SystemE. coli with N-terminal His tag
Purity>90% (SDS-PAGE verified)
Storage Conditions-20°C/-80°C in Tris/PBS buffer with 6% Trehalose; avoid freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in deionized water; 50% glycerol for long-term storage

Research Applications

Recombinant RER1A serves as a critical tool for:

  • Mechanistic studies: Elucidating ER retrieval pathways in plant cells .

  • Protein interaction assays: Identifying binding partners in ER-Golgi trafficking complexes.

  • Comparative genomics: Analyzing functional divergence within the RER1 gene family .

Functional Redundancy and Divergence

All three Arabidopsis RER1 homologs (A, B, C1) complement yeast rer1 mutants, but AtRER1C1 shows reduced efficacy, indicating subfunctionalization .

HomologComplementation EfficiencySequence Identity to Yeast Rer1p
AtRER1AHigh46%
AtRER1BHigh45%
AtRER1C1Moderate39%

Future Directions

Emerging plant-based expression systems (Arabidopsis suspension cultures) offer potential for large-scale production of complex membrane proteins like RER1A, leveraging advantages in post-translational modification fidelity . Current limitations in yield (~0.4 mg/g FW) may be addressed through host engineering (e.g., rdr6-11 mutants to suppress gene silencing) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
RER1A; At4g39220; T22F8.120; Protein RER1A; AtRER1A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RER1A
Target Protein Sequence
MDESGGDSGSVATPVQQRAHEAWRIYQHYLDKTTPHANYRWIGTLVVALIYCLRVYYIQG FYIIAYGLGIYLLNLLIGFLSPLVDPEAGGVSDGPSLPTRGSDEFKPFIRRLPEFKFWYS MTKAFCIAFLMTFFSVFDVPVFWPILLCYWIVLFVLTMRRQIAHMIKYKYIPFSFGKQKY GGRSSSGSRAD
Uniprot No.

Target Background

Function
RER1A plays a crucial role in retrieving endoplasmic reticulum membrane proteins from the early Golgi compartment.
Database Links

KEGG: ath:AT4G39220

STRING: 3702.AT4G39220.1

UniGene: At.472

Protein Families
RER1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of Arabidopsis thaliana RER1A protein?

AtRER1A functions as a retrieval receptor in the early secretory pathway, specifically mediating the return of ER-resident membrane proteins from the Golgi back to the endoplasmic reticulum. Similar to its yeast homolog (Rer1p), AtRER1A recognizes transmembrane domains of certain ER proteins that contain retrieval signals, preventing their mislocalization and maintaining proper compartmentalization of the secretory pathway .

To investigate RER1A function, researchers typically employ complementation assays in yeast rer1 mutants, which can verify functional conservation. The ability of AtRER1A to rescue the mislocalization defect of Sec12p in yeast rer1 mutants confirms its role in protein retrieval mechanisms . Additional functional characterization can be performed through loss-of-function studies using T-DNA insertion lines or CRISPR-Cas9 genome editing in Arabidopsis plants.

How is RER1A protein expression distributed across different tissues and developmental stages?

AtRER1A exhibits ubiquitous expression throughout the plant but shows significant upregulation in tissues with high secretory activity. Expression analysis reveals that AtRER1A transcript levels are notably higher in roots, floral buds, and suspension cultures where secretory pathway activity is elevated . This tissue-specific expression pattern suggests RER1A may play particularly important roles in these actively secreting tissues.

For researchers investigating tissue-specific expression, quantitative RT-PCR and promoter-reporter fusion constructs (such as pRER1A::GUS) provide reliable methodologies. Additionally, RNA-seq analysis of different tissues and developmental stages can reveal expression patterns that might correlate with specific developmental events or stress responses.

What methods are most effective for studying RER1A protein localization?

Determining the subcellular localization of RER1A is crucial for understanding its function. Based on research on similar membrane proteins in Arabidopsis, several complementary approaches are recommended:

  • Fluorescent protein fusions: Creating N- or C-terminal GFP fusions of RER1A for transient expression in Nicotiana benthamiana or stable expression in Arabidopsis. Care must be taken to ensure that the tag doesn't disrupt the transmembrane domains or targeting signals.

  • Immunolocalization: Using specific antibodies against RER1A or epitope tags for immunofluorescence microscopy in fixed plant tissues.

  • Biochemical fractionation: Employing two-phase partitioning and sucrose density gradient centrifugation to identify the membrane compartments where RER1A resides . These techniques have successfully established that similar proteins localize to the endoplasmic reticulum and/or Golgi apparatus.

  • Colocalization studies: Using established markers for ER, Golgi, and other compartments to precisely determine RER1A's distribution within the endomembrane system.

How does AtRER1A compare with its homologs in Arabidopsis and other organisms?

AtRER1A belongs to a larger gene family in Arabidopsis that includes at least three characterized members: AtRER1A, AtRER1B, and AtRER1C1. Sequence analysis reveals:

ProteinSequence Identity to Yeast Rer1pSequence Identity to AtRER1ANotes
AtRER1A39-46%100%Fully complements yeast rer1 mutation
AtRER1B39-46%85%Highly similar to AtRER1A
AtRER1C139-46%~50%Lower complementation efficiency

The Arabidopsis RER1 family appears to be larger than initially characterized, as genomic DNA gel blot analysis indicates the presence of additional AtRER1-related genes . This suggests potential functional specialization among family members. Comparative functional studies using heterologous expression in yeast demonstrate that all three characterized AtRER1 proteins can complement the rer1 mutant, but with varying degrees of efficiency, with AtRER1C1 showing the lowest complementation activity .

What expression systems are recommended for producing recombinant AtRER1A protein?

Several expression systems have proven effective for membrane proteins in Arabidopsis research:

  • Plant-based expression systems: Transient expression in Nicotiana benthamiana leaves using Agrobacterium-mediated transformation is highly effective for producing plant membrane proteins in their native environment with proper post-translational modifications . This system has been successfully used for expressing membrane-associated proteins like AtIRE1a.

  • Yeast expression systems: Saccharomyces cerevisiae can be used for functional complementation studies and protein production, particularly valuable for RER1A given its functional conservation with yeast Rer1p .

  • Bacterial systems with optimization: While challenging for membrane proteins, E. coli expression can be attempted using fusion tags (MBP, SUMO, etc.) and specialized strains designed for membrane protein expression.

For functional studies, consider adding epitope tags or affinity purification tags that allow for protein detection and purification while minimizing interference with protein function.

What are the best approaches for studying membrane dynamics and trafficking of RER1A?

Investigating the dynamic behavior of RER1A in membrane trafficking requires sophisticated methodologies:

  • Live-cell imaging techniques: Employing photoconvertible fluorescent proteins (like mEOS) or photobleaching approaches (FRAP/FLIP) to track RER1A movement between compartments in real-time.

  • Temperature-sensitive trafficking assays: Utilizing temperature shifts (e.g., 16°C blocks in ER-to-Golgi transport) to capture RER1A in transition between compartments.

  • Vesicle immunoisolation: Using antibodies against RER1A or compartment-specific markers to isolate transport vesicles containing RER1A for proteomic analysis of associated proteins.

  • Quantitative membrane association studies: Two-phase partitioning combined with sucrose density gradient sedimentation can be used to determine the precise membrane compartments where RER1A resides, as has been done for other membrane proteins like RPP1A .

  • Chemical genetics approaches: Using specific inhibitors of vesicular trafficking (Brefeldin A, Wortmannin) to dissect RER1A trafficking routes and dependencies.

How can researchers investigate the protein interaction network of RER1A?

Understanding RER1A's function requires characterization of its protein interaction partners:

  • Membrane-based yeast two-hybrid: Modified Y2H systems designed for membrane proteins can identify potential interactors.

  • Co-immunoprecipitation with mass spectrometry: Using epitope-tagged RER1A to pull down interacting proteins from plant extracts, followed by mass spectrometry identification. Crosslinking may be necessary to capture transient interactions.

  • Proximity labeling approaches: BioID or TurboID fusion proteins can biotinylate proteins in close proximity to RER1A in living cells, allowing for subsequent purification and identification.

  • FRET/FLIM analysis: For confirming specific interactions and studying their dynamics in living cells using fluorescently tagged proteins.

  • Genetic interaction screens: Systematic analysis of genetic interactions (synthetic lethality/enhancement) between rer1a mutants and mutations in genes involved in ER-Golgi trafficking.

What methodologies are recommended for studying the role of RER1A in protein quality control?

As a protein involved in the retrieval of ER residents, RER1A likely plays a role in protein quality control:

  • Model substrate trafficking assays: Developing fluorescent reporter proteins with known retrieval signals to quantitatively measure RER1A-dependent retrieval efficiency.

  • Induction of ER stress: Treating plants with tunicamycin or DTT to induce ER stress, then monitoring changes in RER1A localization, expression, and function.

  • Integration with other ER stress response pathways: Investigating potential connections between RER1A and established ER stress response components like IRE1, which has well-developed in vitro assays for measuring activity .

  • Proteomic analysis of substrate fate: Using stable isotope labeling (SILAC) or tandem mass tag (TMT) proteomics to compare the secretome or degradome between wild-type and rer1a mutant plants.

  • Electron microscopy: Analyzing ultrastructural changes in the ER and Golgi in rer1a mutants, particularly under stress conditions.

How should researchers approach the study of copy number variations in RER1A genes across Arabidopsis accessions?

Studies of natural variation in Arabidopsis genes can provide insights into functional significance and evolutionary history:

  • Combining multiple genotyping approaches: As demonstrated in studies of metabolic gene clusters, using a combination of read depth (RD) analysis, multiplex ligation-dependent amplification (MLPA), and droplet digital PCR (ddPCR) provides robust detection of copy number variations .

  • Genomic assembly comparison: Analyzing genomic assemblies from different Arabidopsis accessions to identify potential RER1A duplications, as was done for BARS1/BARS2 .

  • Phylogenetic analysis: Conducting phylogenetic studies of RER1A homologs across accessions to understand evolutionary relationships and potential functional divergence.

  • Expression analysis of variants: Quantifying expression levels of different RER1A variants in various accessions to assess if copy number correlates with expression differences.

  • Functional complementation testing: Testing the ability of RER1A variants from different accessions to complement yeast rer1 mutants or Arabidopsis rer1a knockouts.

What are effective strategies for analyzing the functional redundancy between AtRER1A and its homologs?

The presence of multiple RER1 homologs in Arabidopsis raises questions about functional redundancy:

  • Higher-order mutant analysis: Generating double, triple, etc. mutants of AtRER1A, AtRER1B, and AtRER1C1 to uncover potentially redundant functions. CRISPR-Cas9 can be particularly useful for generating such combinations efficiently.

  • Tissue-specific or inducible silencing: Using artificial microRNAs or RNAi constructs to silence specific combinations of RER1 genes in targeted tissues or developmental stages.

  • Domain swap experiments: Creating chimeric proteins between different RER1 homologs to identify domains responsible for specific functions or localizations.

  • Selective complementation: Expressing individual RER1 homologs in higher-order mutant backgrounds under native or tissue-specific promoters to assess which functions can be rescued by which proteins.

  • Differential interactome analysis: Comparing the interaction partners of different RER1 homologs to identify shared versus specific interaction networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.