Recombinant Arabidopsis thaliana Protein REVERSION-TO-ETHYLENE SENSITIVITY1 (RTE1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RTE1; At2g26070; T19L18.12; Protein REVERSION-TO-ETHYLENE SENSITIVITY1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTE1
Target Protein Sequence
MSRGRGVPMMDLKRSYDVEDRVVSVSIPSIIEADEADLWPLPEIDTKKSKFPCCIVWTPL PVVSWLAPFIGHIGLCREDGVILDFAGSNFINVDDFAFGPPARYLQLDRTKCCLPPNMGG HTCKYGFKHTDFGTARTWDNALSSSTRSFEHKTYNIFTCNCHSFVANCLNRLCYGGSMEW NMVNVAILLMIKGKWINGSSVVRSFLPCAVVTSLGVVLVGWPFLIGLSSFSLLLFAWFII ATYCFKNIIT
Uniprot No.

Target Background

Function
RTE1 functions early in the ethylene signaling pathway. It positively regulates ETR1, consequently suppressing ethylene responses.
Gene References Into Functions

Functional Role of RTE1 in Ethylene Signaling:

  1. RTE1's homolog, RTE1, regulates Arabidopsis RTH in the ethylene signaling pathway. (PMID: 28541511)
  2. The hpr1-5 mutation doesn't reduce gene expression involved in ethylene signaling suppression, highlighting HPR1's selective influence on RTE1 expression and subsequent ethylene response. (PMID: 25680185)
  3. Cb5 and RTE1 collaborate to enhance ETR1-mediated repression of ethylene signaling. (PMID: 24635651)
  4. Studies have evaluated the roles of CTR1 and RTE1 in ETR1 N-terminal signaling. (PMID: 22566492)
  5. The high-affinity interaction between RTE1 and ETR1 is crucial for ETR1 regulation. (PMID: 20952388)
  6. RTE1 negatively regulates ethylene signaling and plays a significant role in ETR1 function. (PMID: 16682642)
  7. Research suggests RTE1's function is specific to ETR1, with endomembranes potentially involved in ethylene signal transduction. (PMID: 17644624)
  8. Subcellular co-localization of RTE1 and ETR1 supports RTE1's role in regulating ETR1. (PMID: 17999643)
  9. RTE1 targets the ethylene-binding domain of ETR1 and positively regulates the ethylene receptor independently of RAN1 activity. (PMID: 18643990)
  10. Dominant etr1 mutations requiring RTE1 for ethylene insensitivity are largely ineffective when transferred to equivalent positions in other ethylene receptor genes. (PMID: 19369589)
Database Links

KEGG: ath:AT2G26070

STRING: 3702.AT2G26070.1

UniGene: At.28087

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Strongly expressed in 1-4-day-old seedlings in the apical hook, cotyledons, root vascular tissue, root tip and root hairs, with little or no expression in the hypocotyl. In light-grown seedlings, expression could also be seen in the apex and young leaves,

Q&A

What is RTE1 and how does it function in ethylene signaling?

RTE1 is a conserved membrane protein that serves as a negative regulator of ethylene responses in Arabidopsis thaliana. RTE1 primarily functions by regulating the activity of at least one of the five ethylene receptors, specifically ETR1 .

Functionally, RTE1:

  • Acts as a positive regulator of ETR1 receptor signaling

  • Promotes the signaling state of ETR1 through the ETR1 N-terminal domain

  • Is induced by ethylene treatment, potentially serving as a negative feedback mechanism

  • Confers reduced ethylene sensitivity when overexpressed, an effect that partially depends on ETR1

The RTE1-ETR1 relationship is specific, as RTE1 is not required for the function of the other four ethylene receptors in Arabidopsis . In the ethylene signaling pathway, RTE1 acts at or upstream of ETR1, not downstream .

How was RTE1 identified and characterized in initial studies?

RTE1 was initially identified through a genetic screen for suppressors of the dominant gain-of-function ethylene-insensitive mutant etr1-2 in Arabidopsis thaliana . The discovery process involved:

  • Isolation of rte1 mutations that suppressed the ethylene insensitivity of the etr1-2 allele

  • Characterization of rte1 loss-of-function mutants, which exhibited enhanced ethylene responses similar to etr1 null phenotypes

  • Generation and analysis of etr1 rte1 double null mutants, which displayed phenotypes identical to either single null mutant, suggesting both genes act in the same pathway

Key evidence from initial studies demonstrated that RTE1:

  • Failed to suppress the etr1-1 gain-of-function allele

  • Failed to suppress gain-of-function mutations in the other four ethylene receptor genes

  • Encodes a previously undescribed predicted membrane protein

The ethylene dose-response assay confirmed that etr1-2 rte1-1 and etr1-2 rte1-2 mutant lines exhibited ethylene responses similar to wild-type plants, verifying the suppression .

What is the subcellular localization of RTE1 and its significance?

RTE1 exhibits specific subcellular localization patterns that provide insights into its function in ethylene signaling:

  • RTE1 is primarily localized to the Golgi apparatus and partially to the endoplasmic reticulum (ER) in Arabidopsis cells

  • This localization was demonstrated using a functional RTE1 fusion to red fluorescent protein (RFP) expressed under the control of the native RTE1 promoter

  • Visualization was performed in stably transformed Arabidopsis protoplasts, roots, and root hairs

The significance of this localization is underscored by:

  • Co-localization with ETR1, which resides not only at the ER as previously reported, but also shows substantial localization at the Golgi apparatus

  • The physical association between RTE1 and ETR1 at these shared locations, as demonstrated through bimolecular fluorescence complementation (BiFC) and co-immunoprecipitation

This co-localization supports the genetic model that RTE1 directly regulates ETR1 function and suggests that both the ER and Golgi may be important sites for ethylene perception and signal transduction .

What methods can be used to study RTE1-ETR1 physical interactions?

Several complementary techniques have been successfully used to demonstrate and characterize the physical association between RTE1 and ETR1:

TechniqueApplicationKey FindingsReference
Bimolecular Fluorescence Complementation (BiFC)In vivo detection in tobacco cellsConfirmed interaction in a transient assay
BiFCIn vivo detection in stably transformed ArabidopsisConfirmed interaction in stable plant system
Co-immunoprecipitationProtein complex isolation from ArabidopsisVerified native protein interaction
Tryptophan fluorescence spectroscopyBinding affinity measurementHigh affinity interaction (Kd = 117 nM)
Yeast split-ubiquitin assayMembrane protein interaction detectionStrong protein-protein interactions between RTE1 and ETR1

The high-affinity binding between RTE1 and ETR1 (Kd = 117 nM) was determined using purified recombinant RTE1 and a tryptophan-less version of purified recombinant ETR1. Notably, an amino acid substitution (C161Y) in RTE1 that confers an ETR1 loss-of-function phenotype correspondingly increased the dissociation constant nearly 12-fold (Kd = 1.38 μM), indicating that high-affinity association is important for proper regulation .

How does RTE1 modulate ETR1 receptor conformation and function?

Current evidence suggests RTE1 influences ETR1 receptor function through several potential mechanisms:

  • Conformational Regulation: RTE1 may affect the conformation of the ETR1 ethylene-binding domain and/or the equilibrium state of ETR1, resulting in promotion or stabilization of the signaling state

  • Target Site: The target site of RTE1 on ETR1 appears to be the ethylene binding domain, suggesting RTE1 promotes ETR1 signal transduction by influencing the conformation of this critical domain

  • Allele-Specific Effects: The allele specificity of suppression suggests RTE1 affects ETR1 function at the protein level rather than at the level of DNA or transcription

  • N-terminal Domain Interaction: RTE1 was shown to interact with the N-terminal portion of ETR1 (amino acids 1-349), suggesting this region is critical for the regulatory relationship

Additional insights come from studies showing that:

  • Wild-type ETR1 N-terminus is sufficient for the activation of RTE1 function

  • Ectopic expression of etr1(1-349) restored ethylene insensitivity conferred by 35S::gRTE1 in etr1-7

  • The RTE1 N-terminus is not essential to the etr1-2 function, as expression of rte1(NΔ49) with an N-terminal deletion of 49 amino acid residues restored ethylene insensitivity in etr1-2 rte1 plants

What is the relationship between RTE1 and its homolog RTH in ethylene signaling?

Arabidopsis contains two members of the RTE1 gene family: RTE1 and RTE1-HOMOLOG (RTH). Their relationship in ethylene signaling reveals both shared and distinct functions:

Similarities between RTE1 and RTH:

  • Both localize to the Golgi apparatus and endoplasmic reticulum (ER)

  • Share similar gene expression patterns

  • Physically interact with each other, as demonstrated by yeast split-ubiquitin assays

  • Both proteins are involved in ethylene signaling

Differences in function:

  • While rte1 mutations suppress ethylene insensitivity conferred by etr1-2, rth mutations do not

  • rte1 mutants show enhanced ethylene sensitivity, while rth mutants exhibit reduced sensitivity to exogenous ethylene

  • RTH overexpression confers ethylene hypersensitivity, in contrast to RTE1 overexpression which reduces ethylene sensitivity

  • Unlike RTE1, RTH does not directly interact with the ETR1 receptor

The evidence suggests RTH acts via RTE1 in regulating ethylene responses and signaling, rather than directly regulating ethylene receptors as RTE1 does. This relationship provides insights into the complexity of ethylene signaling regulation and suggests that RTH may modulate RTE1's function in this pathway .

How is RTE1 expression regulated and where is it expressed in the plant?

RTE1 expression is regulated both developmentally and in response to ethylene:

Expression pattern:

  • RTE1 is expressed at detectable levels in most organs and developmental stages of Arabidopsis

  • Highest expression occurs in the seedling root, root hairs, and apical hook, which correlates with sites of ETR1 expression and ethylene response

Regulation of expression:

  • Ethylene treatment induces RTE1 expression, potentially representing a negative-feedback mechanism in the ethylene-response pathway

  • RTE1 transcript levels are enhanced by ethylene treatment and reduced by inhibition of ethylene signaling

Visualization methods:

  • Arabidopsis plants transformed with the RTE1 promoter fused to the β-glucuronidase (GUS) reporter gene allowed visualization of expression patterns

  • The expression pattern partly correlates with previously described sites of ETR1 expression or sites of ethylene response

The inducibility of RTE1 by ethylene represents an important regulatory mechanism that may help fine-tune ethylene responses during plant development and in response to environmental cues.

How conserved is RTE1 across species and what does this suggest about its function?

RTE1 belongs to a previously unreported family of highly conserved proteins widely distributed in eukaryotes:

Conservation across species:

  • RTE1 homologs have been identified in humans, Drosophila melanogaster, Caenorhabditis elegans, Danio rerio, Plasmodium, and Trypanosoma

  • The human sequence shares 40.5% identity with Arabidopsis RTE1 over 156 amino acids

  • RTE1 is not found in fungi or prokaryotes

  • RTE1 generally exists as a single copy in each species, except in plants: Arabidopsis has two copies (RTE1 and RTH) while rice has three copies

Conservation in crop plants:

  • Tomato (Solanum lycopersicum) contains the GR gene, an ortholog of Arabidopsis RTE1, which was isolated from a dominant non-ripening mutant with elevated GR expression

  • Rice RTE1 homolog (OsRTH1) and RTE-like genes (DCRTE1 and DCRTH1) in carnation participate in ethylene responses in seedling growth and flower senescence

  • In Rosa hybrida, Rh-RTH1 expression is responsive to ethylene and correlates with Rh-ETR1 and Rh-ETR3 expression

This high conservation across diverse eukaryotes suggests RTE1 may serve a fundamental cellular function that has been adapted for ethylene signaling in plants. The absence of known motifs in RTE1 and lack of assigned biological function in non-plant species indicates potentially novel biochemical mechanisms worthy of further investigation .

What are the effects of RTE1 mutations and overexpression on ethylene sensitivity?

Genetic manipulation of RTE1 produces distinctive phenotypes that provide insights into its function:

Effects of rte1 mutations:

  • rte1 loss-of-function mutants display enhanced ethylene responses similar to etr1 null phenotypes

  • In the triple-response assay, rte1 mutants show shorter hypocotyls and roots, similar to etr1-7 null mutants

  • Adult rte1 mutant plants exhibit ethylene-induced senescence, while etr1-2 single mutants remain largely resistant

  • The etr1 rte1 double null mutant is phenotypically identical to either single mutant, suggesting both genes act in the same pathway

Effects of RTE1 overexpression:

  • Overexpression of RTE1 confers reduced ethylene sensitivity

  • This ethylene insensitivity is largely masked by the etr1-7 mutation, but not by mutations in other ethylene receptors

  • The effect is partially dependent on ETR1, highlighting the specificity of the RTE1-ETR1 relationship

Allele-specific effects:

  • rte1 mutations suppress the ethylene insensitivity of the etr1-2 gain-of-function allele

  • rte1 is unable to suppress the etr1-1 gain-of-function allele or gain-of-function mutations in other ethylene receptor genes

  • This allele specificity suggests RTE1 affects ETR1 function at the protein level rather than at DNA or transcription levels

These findings collectively demonstrate that RTE1 is a negative regulator of ethylene signaling that works specifically through the ETR1 receptor.

What methodologies are available for recombinant expression and purification of RTE1?

While the search results don't provide detailed protocols for recombinant RTE1 expression and purification, they do mention successful production of recombinant RTE1 for experimental use. Based on this information, the following methodological approaches can be inferred:

Expression systems:

  • Recombinant RTE1 has been successfully expressed for tryptophan fluorescence spectroscopy studies

  • Since RTE1 is a membrane protein, expression systems suitable for membrane proteins would be appropriate

Purification strategies:

  • Purified recombinant RTE1 was used alongside a tryptophan-less version of purified recombinant ETR1 for binding studies

  • Standard membrane protein purification techniques likely apply, including detergent solubilization followed by affinity chromatography

Functional verification:

  • Interaction with ETR1 can be used to verify the functionality of recombinant RTE1

  • The high-affinity binding (Kd = 117 nM) provides a benchmark for quality control

Potential challenges:

  • As a membrane protein, RTE1 may present challenges in maintaining proper folding and stability

  • The lack of known functional domains or enzymatic activities makes functional verification more challenging

  • Presence of multiple transmembrane domains may require specialized solubilization approaches

For researchers looking to express and purify recombinant RTE1, consulting the methods described in Dong et al. (2010) would provide the most relevant starting point, though adaptation of protocols for membrane protein expression and purification would likely be necessary.

How can researchers measure and quantify RTE1's effects on ethylene sensitivity?

Several established methodologies exist for measuring RTE1's effects on ethylene sensitivity:

Seedling triple-response assay:

  • The most common method for quantifying ethylene sensitivity

  • Measurements include hypocotyl length, root length, and apical hook curvature in dark-grown seedlings exposed to ethylene or its precursor ACC

  • Both rte1 mutants and RTE1 overexpressors show distinct phenotypes in this assay

Ethylene dose-response assays:

  • Used to verify suppression of ethylene insensitivity

  • Exposed seedlings to varying concentrations of ethylene to generate response curves

  • Both etr1-2 rte1-1 and etr1-2 rte1-2 lines exhibited wild-type-like responses in this assay

Gene expression analysis:

  • Quantitative RT-PCR measuring expression of ethylene-responsive genes like ERF1

  • ERF1 is a primary target of ethylene signaling, making it ideal for measuring responsiveness

  • Research showed ERF1 expression was attenuated by about 60% in ctr1-1 lines expressing etr1-1 1-349 or etr1

  • Expression of downstream ERF genes (AtERF8 and AtERF9) by RT-PCR showed that transcript levels in the rth-1 mutant were lower than wild type

Adult plant phenotyping:

  • Assessment of ethylene-induced senescence in adult plants

  • Suppressed mutant lines exhibited ethylene-induced senescence, while etr1-2 single mutants remained largely resistant

These complementary approaches provide a comprehensive toolkit for researchers to quantitatively assess how genetic manipulation of RTE1 affects ethylene sensitivity at different developmental stages.

What other proteins interact with RTE1 besides ETR1?

Recent research has identified several additional RTE1-interacting proteins that expand our understanding of its function:

Interaction with RTH:

  • RTE1 physically interacts with its homolog RTH as demonstrated by yeast split-ubiquitin assays

  • Both the N-terminus (residues 1-54) and C-terminus of RTH (residues 181-231) are required for this protein interaction

  • RTH can form homodimers in cells, suggesting potential for complex formation

Interaction with cytochrome b5:

  • RTE1 interacts with cytochrome b5 (AtCb5)

  • The atcb5 mutants show increased ethylene sensitivity

  • Overexpression of AtCb5-D confers decreased ethylene sensitivity

Interaction with lipid transfer protein:

  • RTE1 interacts with a lipid transfer protein LTP1

  • The ltp1 knockout exhibits increased sensitivity to exogenous ACC

  • LTP1 overexpression confers decreased sensitivity to ACC

These interactions suggest RTE1 may function as part of a protein complex involved in the regulation of ethylene signal transduction through the ETR1 receptor. Both AtCb5 and LTP1 play positive roles in ethylene signaling, potentially by participating in this complex. The discovery of these additional interactions provides new avenues for understanding the molecular mechanisms of RTE1 function and ethylene receptor regulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.