Recombinant Arabidopsis thaliana Protein RTE1-HOMOLOG (RTH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates. Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize fulfilling this request.
Synonyms
RTH; At3g51040; F24M12.80; Protein RTE1-HOMOLOG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTH
Target Protein Sequence
MGETATDSEHRMMIGLSDPMKIDPKRDRFPCCIVWTPLPFISWLVPFIGHVGICREDGVI LDFAGPNFVCVDNFAFGAVSRYIQINKEMESSRSSSSGMFNGERRYEQEEDSHEKEPTWD DALRKSTQEYQHHSYNILTCNCHSFVANNLNRLSIKSGGWNVVNLATLVLFKGRWVNKTA IVKSLLPPLIVYTIGILLGGWTFIASCSILVVLLTGWFIIGTYCFKKLIQL
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G51040

STRING: 3702.AT3G51040.1

UniGene: At.851

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is RTH and how does it relate to RTE1 in Arabidopsis thaliana?

RTH (RTE1-HOMOLOG) is the only homolog of RTE1 (REVERSION-TO-ETHYLENE SENSITIVITY1) in Arabidopsis thaliana. It encodes a protein of 231 amino acids that shares 51% identity with RTE1 over 209 amino acids . Both belong to a gene family highly conserved in animals, plants, and lower eukaryotes, though absent in fungi and prokaryotes . While RTE1 is known to be a positive regulator of the ETR1 ethylene receptor, RTH functions differently in ethylene signaling pathways . Studies have shown that RTH and RTE1 interact physically, and evidence suggests that RTH acts via RTE1 in regulating ethylene responses and signaling .

What methods are effective for studying RTH subcellular localization?

To study RTH subcellular localization, researchers should employ the following methodology:

  • Fluorescent protein fusion constructs: Generate N- or C-terminal fusions of RTH with fluorescent proteins such as GFP or YFP under the control of a suitable promoter (constitutive or native).

  • Transient expression systems: Use Agrobacterium-mediated transformation of tobacco leaves for initial localization studies.

  • Co-localization markers: Include established organelle markers for ER (e.g., BiP-RFP) and Golgi apparatus (e.g., ST-RFP).

  • Stable Arabidopsis transformants: Generate stable Arabidopsis lines expressing RTH-fluorescent protein fusions for in vivo verification.

  • Confocal microscopy: Perform multi-channel imaging to determine co-localization with organelle markers.

Research has confirmed that RTH, like RTE1, co-localizes with both the endoplasmic reticulum (ER) and Golgi apparatus in plant cells . This pattern of localization provides important context for understanding RTH function in ethylene signaling.

How do RTH mutants and overexpression lines affect ethylene sensitivity in Arabidopsis?

Effects on Ethylene Response:

GenotypeEthylene SensitivityPhenotypic Manifestation
Wild-typeNormalStandard triple response to ethylene
rth knockoutDecreased sensitivityLess responsive to exogenous ethylene
RTH overexpressionHypersensitivityEnhanced response, especially at low ethylene concentrations
rte1 mutantMild hypersensitivitySlightly enhanced triple response

The rth knockout mutants (rth-1, rth-2) exhibit reduced sensitivity to exogenous ethylene, while RTH overexpression confers ethylene hypersensitivity, particularly under low ACC (1-aminocyclopropane-1-carboxylic acid) concentrations (0.5 μM) . This contrasts with rte1-3 mutants, which show a slightly hypersensitive phenotype in response to exogenous ethylene . These differential responses provide important clues about the distinct roles of RTH and RTE1 in ethylene signaling.

What molecular techniques are available for detecting RTH-RTE1 protein interactions?

Several complementary approaches should be employed to comprehensively study RTH-RTE1 protein interactions:

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein fragments (e.g., YFP) fused to RTH and RTE1

    • Expression in tobacco leaves via Agrobacterium infiltration

    • Visualization of interaction via restored fluorescence

    • Controls: non-interacting protein pairs

  • Co-immunoprecipitation (Co-IP):

    • Express epitope-tagged versions of RTH and RTE1 in Arabidopsis

    • Extract membrane proteins using appropriate detergents

    • Immunoprecipitate one protein and detect the other by Western blotting

    • Controls: unrelated membrane proteins

  • Tryptophan Fluorescence Spectroscopy:

    • Express and purify recombinant proteins

    • Measure changes in intrinsic tryptophan fluorescence upon binding

    • Calculate binding affinity (Kd)

    • Similar to the approach used for RTE1-ETR1 interaction studies

  • Yeast Two-Hybrid (Y2H) with Split-Ubiquitin System:

    • Suitable for membrane proteins

    • Fusion of proteins with N- and C-terminal ubiquitin fragments

    • Detection via release of a transcription factor

Research has confirmed physical association between RTH and RTE1 using multiple methods, indicating that this interaction plays a significant role in regulating ethylene responses .

How should experiments be designed to differentiate the functions of RTH and RTE1 in ethylene signaling?

A comprehensive experimental design to differentiate RTH and RTE1 functions requires multiple approaches:

  • Genetic Complementation Analysis:

    • Generate constructs with RTH and RTE1 coding sequences under the same promoter

    • Transform rte1 and rth single mutants with both constructs

    • Assess if RTH can complement rte1 phenotypes and vice versa

    • Measure ethylene responses quantitatively in complemented lines

  • Domain Swapping Experiments:

    • Create chimeric proteins with swapped domains between RTH and RTE1

    • Express in respective mutant backgrounds

    • Identify which domains are responsible for specific functions

    • Analyze ethylene sensitivity using triple response assays

  • Double Mutant Analysis:

    • Generate rth rte1 double mutants

    • Compare with single mutants and wild-type

    • Assess ethylene response at multiple ACC concentrations (0, 0.1, 0.5, 1, 10 μM)

    • Measure root and hypocotyl growth quantitatively

  • Transcriptome Analysis:

    • Perform RNA-seq on wild-type, rth, rte1, and rth rte1 mutants

    • Include both ethylene-treated and untreated conditions

    • Identify differentially regulated genes specific to each genotype

    • Validate key genes by qRT-PCR

  • Protein-Protein Interaction Network Mapping:

    • Perform immunoprecipitation coupled with mass spectrometry

    • Identify proteins that interact uniquely with either RTH or RTE1

    • Validate key interactions with BiFC or Co-IP

Current research has already shown key differences: unlike RTE1, RTH does not suppress the ethylene insensitivity conferred by etr1-2 . Additionally, rth mutants show reduced sensitivity to ethylene while rte1 mutants exhibit mild hypersensitivity, suggesting divergent functions .

What approaches are recommended for investigating the molecular mechanism of RTH regulation of RTE1?

To investigate how RTH regulates RTE1 at the molecular level, researchers should implement:

  • Site-Directed Mutagenesis:

    • Identify conserved residues between RTH and RTE1

    • Generate point mutations in RTH

    • Express mutated versions in rth background

    • Assess effects on RTH-RTE1 interaction and ethylene responses

    • Particularly focus on residues equivalent to the C161Y mutation in RTE1 that increases Kd with ETR1

  • Protein Stability Assays:

    • Express epitope-tagged RTE1 in wild-type and rth backgrounds

    • Perform cycloheximide chase experiments

    • Western blot at multiple time points

    • Quantify protein degradation rates

    • Test effects of proteasome inhibitors

  • Subcellular Localization Studies:

    • Co-express fluorescently tagged RTH and RTE1

    • Perform live cell imaging in presence/absence of ethylene

    • Track potential changes in localization patterns

    • Use pharmacological inhibitors of trafficking

  • Structural Biology Approaches:

    • Generate recombinant proteins for structural studies

    • Employ X-ray crystallography or cryo-EM

    • Determine the binding interface between RTH and RTE1

    • Model how this affects RTE1-ETR1 interaction

  • Biochemical Activity Assays:

    • Test if RTH affects RTE1 post-translational modifications

    • Investigate potential changes in RTE1 conformation

    • Measure RTE1-ETR1 binding affinity in presence/absence of RTH

Current research suggests that RTH may modulate ethylene signaling via RTE1, but the exact molecular mechanism remains to be elucidated .

How can researchers reconcile the contrasting ethylene sensitivity phenotypes between rth and rte1 mutants?

Reconciling these contrasting phenotypes requires a systematic experimental approach:

  • Detailed Dose-Response Analysis:

    • Test rth, rte1, and wild-type seedlings under a fine gradient of ACC concentrations (0.01-100 μM)

    • Measure multiple parameters: hypocotyl length, root length, apical hook curvature

    • Generate comprehensive dose-response curves

    • Calculate EC50 values for each response

  • Temporal Analysis of Ethylene Response:

    • Time-course experiments measuring the kinetics of response

    • Track gene expression changes of ethylene-responsive genes over time using qRT-PCR

    • Focus on early (ERF1, ETR2) and late (PDF1.2, CHIB) responsive genes

    • Compare response timing between mutants

  • Genetic Interaction Studies:

    • Generate higher-order mutants with other ethylene signaling components

    • Test combinations with ein2, ein3, eil1, and other key signaling proteins

    • Determine epistatic relationships

    • Place RTH and RTE1 more precisely in the signaling pathway

  • Biochemical Analysis of Signaling Components:

    • Measure ETR1 receptor activity in both mutant backgrounds

    • Analyze CTR1 kinase activity

    • Track EIN2 C-terminal cleavage and nuclear localization

    • Assess EIN3 protein stability

  • Tissue-Specific Analysis:

    • Generate tissue-specific complementation lines

    • Use root, hypocotyl, and apical hook-specific promoters

    • Determine if contrasting phenotypes are tissue-dependent

Current research reveals that rth mutants exhibit reduced sensitivity to exogenous ethylene, while rte1 mutants show slight hypersensitivity . This suggests RTH may negatively regulate ethylene responses, potentially by modulating RTE1 function, which is a positive regulator of ETR1 .

What experimental designs are optimal for investigating RTH's role in root development independent of ethylene signaling?

To separate RTH's ethylene-dependent and independent functions in root development:

  • Ethylene-Insensitive Background Studies:

    • Generate rth ein2 and rth etr1-1 double mutants

    • Compare root phenotypes with single mutants

    • Measure primary root length, lateral root number, and root hair development

    • Conduct these analyses in absence of exogenous ethylene

  • Pharmacological Approach:

    • Use ethylene biosynthesis inhibitors (e.g., AVG) and perception inhibitors (e.g., 1-MCP)

    • Compare root development in rth and wild-type under these conditions

    • Include ethylene precursor ACC as control

    • Track root growth parameters over time

  • Cell-Type Specific Expression Analysis:

    • Use fluorescence-activated cell sorting (FACS) with cell-type specific GFP markers

    • Isolate RNA from specific root cell types

    • Perform RT-qPCR or RNA-seq to identify RTH-regulated genes

    • Compare with ethylene-responsive transcriptome data

  • Hormone Cross-Talk Investigation:

    • Test sensitivity of rth mutants to other hormones affecting root development:

      • Auxin (IAA, NAA)

      • Cytokinin (zeatin, BAP)

      • Abscisic acid

      • Gibberellic acid

    • Measure dose-response relationships

    • Test combinations of hormones

  • Cell Division and Elongation Studies:

    • Use cell-cycle markers (e.g., CYCB1;1:GUS)

    • Measure meristem size and cell elongation zone

    • Track cell division rates using EdU incorporation

    • Analyze cortical microtubule organization

Current research has established that knockout of RTH promotes seedling primary growth and lateral root initiation, suggesting RTH may function in additional cellular activities beyond ethylene signaling regulation . This phenotype warrants further investigation to determine the molecular mechanisms involved.

How can researchers effectively measure the binding affinity between RTH and RTE1 proteins?

To accurately determine RTH-RTE1 binding kinetics and affinity:

  • Tryptophan Fluorescence Spectroscopy:

    • Express and purify recombinant RTH and RTE1 proteins

    • Generate tryptophan-less versions through site-directed mutagenesis

    • Measure changes in intrinsic tryptophan fluorescence upon protein-protein interaction

    • Titrate increasing concentrations to generate binding curves

    • Calculate dissociation constant (Kd)

    • This approach has successfully determined ETR1-RTE1 binding (Kd = 117 nM)

  • Surface Plasmon Resonance (SPR):

    • Immobilize one protein on a sensor chip

    • Flow the partner protein at various concentrations

    • Measure real-time association and dissociation

    • Determine ka, kd, and Kd values

    • Compare wild-type with mutant versions

  • Microscale Thermophoresis (MST):

    • Label one protein with fluorescent dye

    • Mix with increasing concentrations of unlabeled partner

    • Measure changes in thermophoretic mobility

    • Calculate binding affinity

    • Suitable for membrane proteins in detergent solutions

  • Isothermal Titration Calorimetry (ITC):

    • Directly measure heat changes during binding

    • No protein modification needed

    • Determine thermodynamic parameters (ΔH, ΔS, ΔG)

    • Requires larger amounts of purified proteins

  • Bio-Layer Interferometry (BLI):

    • Immobilize one protein on biosensor tips

    • Measure interference pattern changes upon binding

    • Real-time kinetics without microfluidics

    • Determine association and dissociation rates

Research using tryptophan fluorescence spectroscopy has shown that RTE1 interacts with ETR1 with high affinity (Kd = 117 nM), and that specific mutations can significantly affect this interaction (e.g., C161Y increases Kd to 1.38 μM) . Similar approaches would be valuable for characterizing RTH-RTE1 interactions.

What strategies can be employed to identify additional protein interactors of RTH beyond RTE1?

To comprehensively identify the RTH interactome:

  • Membrane-Based Yeast Two-Hybrid (MYTH) Screening:

    • Use split-ubiquitin based Y2H system designed for membrane proteins

    • Screen RTH against Arabidopsis cDNA libraries

    • Validate positive interactions with secondary assays

    • Compare with known RTE1 interactors

  • Proximity-Dependent Biotin Identification (BioID):

    • Generate RTH fusions with biotin ligase (BioID2 or TurboID)

    • Express in Arabidopsis

    • Isolate biotinylated proteins using streptavidin

    • Identify by mass spectrometry

    • Controls: unfused biotin ligase, catalytically inactive versions

  • Co-Immunoprecipitation Coupled with Mass Spectrometry:

    • Express epitope-tagged RTH in Arabidopsis

    • Perform immunoprecipitation under native conditions

    • Analyze co-purified proteins by LC-MS/MS

    • Use label-free quantification or SILAC for quantitative comparison

    • Compare RTH interactome with RTE1 interactome

  • In vivo Cross-Linking:

    • Treat plants expressing tagged RTH with membrane-permeable crosslinkers

    • Stabilize transient interactions

    • Perform stringent immunoprecipitation

    • Identify interactors by mass spectrometry

  • Genetic Suppressor/Enhancer Screens:

    • Mutagenize rth mutants or RTH overexpression lines

    • Screen for restoration or enhancement of phenotypes

    • Map mutations to identify genetic interactors

    • Validate with direct protein interaction studies

The current research has already identified interactions between RTH and RTE1, suggesting a regulatory relationship . RTE1 has also been shown to interact with cytochrome b5 and the lipid transfer protein LTP1 , indicating potential areas to explore for RTH interactions as well.

How should experiments be designed to investigate the evolutionary conservation of RTH function across plant species?

To assess evolutionary conservation of RTH function:

  • Phylogenetic Analysis and Sequence Comparison:

    • Identify RTH homologs across plant lineages

    • Include bryophytes, lycophytes, gymnosperms, and diverse angiosperms

    • Perform multiple sequence alignment

    • Identify conserved domains and residues

    • Reconstruct phylogenetic relationships

  • Heterologous Complementation Tests:

    • Clone RTH orthologs from diverse plant species

    • Express in Arabidopsis rth mutant background

    • Assess complementation of ethylene response phenotypes

    • Test both monocot and dicot orthologs

  • Domain Function Analysis:

    • Create chimeric proteins with domains from different species

    • Express in Arabidopsis rth mutant

    • Identify functionally conserved domains

    • Focus on interaction surfaces based on conserved residues

  • Protein Interaction Conservation:

    • Test interaction of RTH orthologs with Arabidopsis RTE1

    • Use BiFC or Co-IP approaches

    • Compare binding affinities

    • Determine if interaction interfaces are conserved

  • Comparative Expression and Phenotypic Analysis:

    • Generate CRISPR/Cas9 knockout or RNAi lines in crop species

    • Compare phenotypes with Arabidopsis rth mutants

    • Focus on ethylene response and root development

    • Assess expression patterns in different species

Research has shown that the RTE1 gene family is highly conserved in animals, plants, and lower eukaryotes, but no biological function has been assigned to this protein family outside of plants . In tomato, three homologs of RTE1 exist, one of which regulates ethylene responses . In rice, OsRTH1 participates in modulating ethylene responses in seedling growth . These findings suggest evolutionary conservation with potential functional diversification.

What experimental controls are crucial for studies involving recombinant RTH protein?

When working with recombinant RTH protein, implement these critical controls:

  • Protein Quality Controls:

    • Size-exclusion chromatography to verify monodispersity

    • Circular dichroism to confirm proper folding

    • Thermostability assays to ensure protein stability

    • Western blot with specific antibodies to confirm identity

    • Compare wild-type RTH with known non-functional mutants

  • Expression System Controls:

    • Empty vector controls in all expression systems

    • Comparative analysis across different expression systems:

      • Bacterial (E. coli)

      • Yeast (P. pastoris)

      • Insect cells (Sf9)

      • Plant-based (N. benthamiana)

    • Test for post-translational modifications that may affect function

  • Biological Activity Verification:

    • Complementation of rth mutant phenotypes

    • Interaction assays with known partners (RTE1)

    • Compare activity of bacterially-expressed vs. plant-expressed protein

  • Negative Controls for Interaction Studies:

    • Unrelated membrane proteins of similar size and topology

    • Mutated versions of RTH with abolished binding capacity

    • Competition assays with unlabeled proteins

  • Subcellular Targeting Controls:

    • Verification of proper membrane insertion

    • Protease protection assays to confirm topology

    • Comparison with native RTH localization patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.