Recombinant Arabidopsis thaliana Protein TIC 20-II, chloroplastic (TIC20-II)

Shipped with Ice Packs
In Stock

Description

Introduction to TIC20-II

Recombinant Arabidopsis thaliana Protein TIC 20-II, chloroplastic (TIC20-II) is a polytopic membrane protein localized to the inner envelope membrane of chloroplasts. It belongs to the TIC (translocon at the inner envelope membrane of chloroplasts) complex, which facilitates the transport of nuclear-encoded proteins into plastids . In Arabidopsis thaliana, four Tic20 homologues exist, with TIC20-II (AT2G47840) classified in Group 2 of the Tic20 family, phylogenetically distinct from Group 1 (e.g., TIC20-I and TIC20-IV) .

Phylogenetic Context and Functional Redundancy

The Tic20 family is divided into two clades:

  • Group 1: Includes TIC20-I and TIC20-IV (essential for chloroplast development).

  • Group 2: Includes TIC20-II and TIC20-V (non-essential but conserved across land plants) .

Key insights:

  • TIC20-II exhibits partial redundancy with TIC20-V but lacks the substrate specificity of Group 1 proteins .

  • Mutant studies reveal that TIC20-II is dispensable in wild-type plants but may support residual protein import in TIC20-I knockout mutants .

  • Evolutionary analysis suggests Group 2 proteins (e.g., TIC20-II) diverged ~1.2 billion years ago but retain conserved structural motifs .

Recombinant Protein Production and Applications

Recombinant TIC20-II is produced via bacterial expression systems (e.g., E. coli) or cell-free methods, with purity exceeding 85% .

ParameterDetails
Host SystemE. coli, yeast, or cell-free expression
TagHis-tagged (e.g., N-terminal)
Purity≥85% (SDS-PAGE validated)
ApplicationsStructural studies, antibody production, and biochemical assays

Suppliers include CD BioSciences (RP09046), Creative Biomart (RFL15442AF), and Cusabio (CSB-CF526861DOA), offering variants for experimental flexibility .

Research Findings and Functional Insights

Critical studies highlight TIC20-II’s role:

  • Tissue-Specific Expression: TIC20-IV compensates for TIC20-I loss in roots, but TIC20-II remains expressed in shoots .

  • Substrate Specificity: TIC20-II may preferentially import housekeeping proteins (e.g., stromal enzymes) over photosynthetic proteins .

  • Evolutionary Adaptation: Group 2 proteins (including TIC20-II) show accelerated evolutionary rates, likely linked to terrestrial plant adaptation .

Functional Studies in Mutant Plants

Mutant LinePhenotypeKey Observations
tic20-IAlbino, seedling-lethal; impaired chloroplast development Accumulates non-photosynthetic proteins
tic20-I tic20-IVEmbryonic lethality; no compensation by TIC20-II Confirms essentiality of Group 1 proteins
tic20-I tic20-IIAlbino; partial rescue via TIC20-IV overexpression TIC20-II contributes minimally to photosynthetic protein import

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order notes. We will accommodate your request as best as possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and protein stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize the development of that tag.
Synonyms
TIC20-II; At2g47840; F17A22.23; Protein TIC 20-II, chloroplastic; Translocon at the inner envelope membrane of chloroplasts 20-II; AtTIC20-II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
50-208
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TIC20-II
Target Protein Sequence
ASYTPTPATERVISIASYALPFFNSLQYGRFLFAQYPRLGLLFEPIFPILNLYRSVPYAS FVAFFGLYLGVVRNTSFSRYVRFNAMQAVTLDVLLAVPVLLTRILDPGQGGGFGMKAMMW GHTGVFVFSFMCFVYGVVSSLLGKTPYIPFVADAAGRQL
Uniprot No.

Target Background

Function
This protein may be involved in protein precursor import into chloroplasts. It is not redundant with TIC20-I, TIC20-IV or TIC20-V.
Database Links

KEGG: ath:AT2G47840

STRING: 3702.AT2G47840.1

UniGene: At.12945

Protein Families
Tic20 family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in leaves, siliques and roots.

Q&A

What is TIC20-II and what is its function in plant cells?

TIC20-II is a component of the TIC (translocon at the inner envelope membrane of chloroplasts) protein translocation machinery that mediates protein translocation across the inner envelope of plastids. It is one of four Tic20 homologous proteins in Arabidopsis, with the others being TIC20-I (AT1G04940), TIC20-IV (AT4G03320), and TIC20-V (AT5G55710) . TIC20-II functions as part of the protein import apparatus that allows nucleus-encoded proteins to enter chloroplasts after being synthesized in the cytosol .

Methodologically, researchers investigating TIC20-II function typically employ protein localization techniques, protein-protein interaction assays, and genetic knockout/knockdown approaches to determine its specific role in chloroplast protein import.

How does TIC20-II relate structurally and functionally to other TIC20 family members?

Phylogenetic analysis reveals that TIC20-related proteins form two distinct clades, termed Group 1 and Group 2. TIC20-II belongs to Group 2, while the more extensively characterized TIC20-I belongs to Group 1 . Structurally, TIC20-II and TIC20-V show higher similarities to each other than to TIC20-I or TIC20-IV. Conversely, TIC20-I is more closely related to TIC20-IV than to either TIC20-II or TIC20-V .

Functionally, Group 1 proteins (including TIC20-I) are considered canonical Tic20 proteins that are essential for chloroplast development, while Group 2 members (including TIC20-II) have functions that are less well characterized . This structural grouping has significant implications for functional analyses and experimental design when studying these proteins.

What expression patterns does TIC20-II exhibit in Arabidopsis tissues?

While the search results don't provide specific information about TIC20-II expression patterns, they do indicate that TIC20-IV is expressed mainly in roots, whereas TIC20-I is more abundant in shoots than in roots . By inference and based on homology relationships, researchers should consider that TIC20-II might have tissue-specific expression patterns that differ from those of TIC20-I and TIC20-IV.

To methodologically investigate TIC20-II expression patterns, researchers typically employ techniques such as qRT-PCR, RNA-seq, or promoter-reporter gene fusions to analyze tissue-specific and developmental expression profiles.

How can researchers effectively design experiments to distinguish the specific functions of TIC20-II from other TIC20 homologs?

Given the presence of four TIC20 homologs in Arabidopsis, designing experiments that specifically target TIC20-II requires careful consideration. Researchers should:

  • Employ gene-specific knockout or knockdown strategies using CRISPR/Cas9 or RNAi approaches with highly specific targeting sequences

  • Create double or triple mutants to assess functional redundancy

  • Use epitope tagging specific to TIC20-II for immunoprecipitation and localization studies

  • Conduct complementation studies with various TIC20 homologs in tic20-ii mutant backgrounds

The study of tic20-i knockout mutants has demonstrated that TIC20-I is essential for protein import into chloroplasts, with mutants exhibiting severe albino and seedling-lethal phenotypes . Similar rigorous approaches should be applied to TIC20-II research, with the caveat that TIC20-II mutation phenotypes may be more subtle due to potential functional redundancy.

What techniques are most effective for producing and purifying recombinant TIC20-II protein for structural and functional studies?

Producing recombinant TIC20-II presents challenges due to its membrane-embedded nature. Recommended methodological approaches include:

  • Expression in bacterial systems using specialized vectors designed for membrane proteins

  • Inclusion of solubility tags (e.g., MBP, SUMO) to enhance expression and solubility

  • Optimization of detergent conditions for extraction and purification

  • Consideration of cell-free expression systems for enhanced yield

For antibody-based detection and purification, researchers can use specifically designed antibodies such as the rabbit polyclonal antibody described in the literature, which targets a synthetic peptide (13 amino acids) from the N-terminal section of Arabidopsis thaliana TIC20-II .

How has the evolutionary rate of TIC20 family proteins influenced their functional divergence?

Phylogenetic analyses have revealed an increased evolutionary rate in Group 1 TIC20 proteins, connected with adaptation to terrestrial life . This evolutionary pattern has significant implications for functional divergence among TIC20 family members.

Research approaches to investigate this functional divergence should include:

  • Comparative genomic analyses across species with different evolutionary histories

  • Structural modeling to identify conserved versus divergent domains

  • Site-directed mutagenesis of evolutionarily significant residues

  • Complementation studies using TIC20 homologs from diverse species

The observed evolutionary patterns suggest that TIC20-II and TIC20-V might retain ancestral functions, while TIC20-I and TIC20-IV may have evolved specialized roles, particularly in terrestrial plant adaptations .

What is the significance of the subcellular genomic localization differences of TIC20 genes across evolutionary lineages?

An intriguing aspect of TIC20 evolution is that the subcellular (genomic) localization of genes coding for Group 1 proteins differs between evolutionary lineages. For example, in the red alga Cyanidioschyzon merolae, the Group 1 protein is plastid-encoded, while its Group 2 paralog is nucleus-encoded .

This finding suggests:

  • Nuclear localization of TIC20 genes is not essential for their function

  • Gene transfer events from plastid to nucleus have occurred independently in different lineages

  • Functional constraints may have influenced the retention of certain TIC20 homologs in specific genomic compartments

Researchers investigating TIC20-II should consider these evolutionary patterns when designing comparative studies or when interpreting functional data across species.

What are the optimal conditions for detecting TIC20-II using Western blot analysis?

Based on available antibody information, researchers should consider the following methodological approaches for Western blot detection of TIC20-II:

  • Sample preparation: Use specialized methods for membrane protein extraction

  • Gel electrophoresis: 12% SDS-PAGE is recommended

  • Transfer: Blot to nitrocellulose (NC) membrane for 1 hour

  • Antibody dilution: Use anti-TIC20-II antibody at 1:1000-1:2000 dilution

  • Expected molecular weight: Approximately 23 kDa

  • Controls: Include recombinant protein standards (2.5 ng, 10 ng, and 25 ng) containing the immunization peptide

For verification of specificity, researchers should be aware that the synthetic peptide used for immunization shows 100% homology with sequences in Brassica rapa and Brassica napus, suggesting cross-reactivity with TIC20-II from these species .

How can researchers distinguish between direct and indirect effects in TIC20-II functional studies?

Distinguishing direct from indirect effects in TIC20-II studies requires rigorous experimental design:

  • Time-course experiments to establish cause-effect relationships

  • Inducible expression or knockdown systems for temporal control

  • Domain-specific mutations to identify functional regions without complete protein elimination

  • Protein-protein interaction studies using techniques like split-ubiquitin yeast two-hybrid assays specific for membrane proteins

  • In vitro reconstitution experiments with purified components

Lessons from TIC20-I studies show that even in knockout mutants, non-photosynthetic housekeeping proteins can still be imported into plastids, suggesting functional specificity or partial redundancy among TIC20 family members . Similar nuanced approaches should be applied to TIC20-II research.

What considerations are important when designing complementation studies for TIC20-II mutants?

Complementation studies are essential for confirming gene function and exploring structure-function relationships. For TIC20-II, researchers should consider:

  • Use of native promoters versus constitutive promoters (potential overexpression artifacts)

  • Tissue-specific expression controls

  • Inclusion of appropriate epitope tags that don't interfere with function

  • Cross-complementation with other TIC20 family members to assess functional redundancy

  • Species-specific versus cross-species complementation to explore evolutionary conservation

Research on TIC20-I has shown that overexpression of TIC20-IV in tic20-i mutants only marginally rescues the accumulation of photosynthetic proteins . Similar experiments with TIC20-II would provide valuable insights into its specific functions and potential redundancy with other family members.

How should researchers interpret phenotypic data from TIC20-II mutants in light of potential functional redundancy?

The interpretation of TIC20-II mutant phenotypes requires careful consideration of functional redundancy:

  • Compare single, double, and higher-order mutant phenotypes systematically

  • Analyze tissue-specific effects that might be masked in whole-plant studies

  • Examine effects under various environmental conditions that might reveal conditional phenotypes

  • Conduct quantitative protein import assays using diverse substrate proteins

In TIC20-I research, the double knockout mutant of TIC20-I and TIC20-IV exhibits more severe embryonic lethality than the single tic20-i mutant . This finding highlights the importance of examining multiple gene knockouts when studying potentially redundant gene families like TIC20.

What methodological approaches can resolve contradictory data regarding TIC20-II function?

When facing contradictory data about TIC20-II function, researchers should employ these methodological approaches:

  • Standardize experimental conditions across studies

  • Use multiple independent techniques to measure the same parameter

  • Conduct genetic interaction studies with other import machinery components

  • Perform detailed structure-function analyses to identify critical domains

  • Use in vitro and in vivo approaches in parallel to cross-validate findings

The distinct substrate preferences observed between TIC20 family members highlight the importance of using diverse substrate proteins when assessing import function, as contradictory results might reflect substrate specificity rather than technical issues.

How might understanding TIC20-II function contribute to engineering improved chloroplast protein targeting?

Research into TIC20-II has potential applications in chloroplast engineering:

  • Development of optimized transit peptides for efficient protein import

  • Creation of substrate-specific import pathways for biotechnological applications

  • Engineering of chloroplast import machinery for non-native protein targeting

  • Modification of import efficiency to enhance metabolic engineering efforts

Understanding the substrate preferences of different TIC20 family members could enable the design of transit peptides that preferentially engage specific import pathways, potentially improving the efficiency of chloroplast-targeted recombinant proteins.

What emerging technologies might advance research on TIC20-II structure and function?

Several emerging technologies hold promise for advancing TIC20-II research:

  • Cryo-electron microscopy for structural determination of membrane protein complexes

  • Proximity labeling approaches (BioID, APEX) to identify transient interaction partners

  • Single-molecule imaging to track import kinetics in real-time

  • Nanobody-based detection systems for improved specificity in localization studies

  • Advanced genome editing with prime editing or base editing for precise genetic manipulation

These technologies could help resolve long-standing questions about the exact molecular mechanism by which TIC20-II participates in protein translocation across the chloroplast inner envelope.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.